5N7I


Conserved Protein Domain Family
Occludin_ELL

?
pfam07303: Occludin_ELL 
Click on image for an interactive view with Cn3D
Occludin homology domain
This domain represents a conserved region approximately 100 residues long within eukaryotic occludin proteins and the RNA polymerase II elongation factor ELL. Occludin is an integral membrane protein that localizes to tight junctions, while ELL is an elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. This shared domain is thought to mediate protein interactions.
Statistics
?
PSSM-Id: 399941
View PSSM: pfam07303
Aligned: 98 rows
Threshold Bit Score: 70.2389
Threshold Setting Gi: 674573957
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N7I_A         10 YPVIQTDDEREAYKAVFQDQFSEYKELSAEVQAVLRKFDELD---------AVMSRLPHHSEs---rQEHEAISRIHEEF 77  
EFC44015      228 ISKIETFEQYNQYKKEFNENYKKYKELDKILNDNVEYFKGLA---------SEWKTLPNDEKtesnnEIQKLFNR----- 293  Naegleria gru...
ERN06594     1128 RGPIKDDAQYKEYTKEYSEKHSCYSSLYKLLESERADFEKFR---------RDLEHAKDRDMd----SYNNIVERIIQSY 1194 Amborella tri...
XP_006651113 1066 KGPIKDLPQYKDYVQEYNEKYEVYSYLNSQIEKTRSEFLKIQ---------EDLNSAKERDKd----LYYRILERIRDMY 1132 malo sina
XP_002276282 1149 KGPIKDFSQYKEYVQEYHEKYDSYNSLNKILESYRNEFHKLG---------KDLEVAKGRDLe----RYYNILEQLKDTY 1215 wine grape
XP_004236392 1124 KGPIENFAQYEEYVQEYREKYDSYCSINKILESYRNEFIKLG---------KELDVSKGRDTk----RFSDMLGQLKDSY 1190 tomato
KRH44202      933 KGPIRTFSQYKEYVQEFQDKYDSYCSLNKILEGYRDEFQKLG---------NDLEHAKGRDMd----RYYDIVEQLKESY 999  soybean
NP_566681    1088 KGPISDHLQYKAYMQEYNDKYDSYHSINKILESHRNDFQKLG---------QDLGFAKGRDVe----RYNKIVEQIKESY 1154 thale cress
Q9N554        552 FGDIKTLSEAEAYFKQFHKEYPLYMECHEMLTKVSSEFRGLEvklltavalSKTSPSPQNMQ-----NVKQIEKNIQNRY 626  Caenorhabditi...
CDS40880      620 YPAISSASQAAAYREAFESLYPKYLRLYEHFRVAWDKVINLK---------ERILALAGGPHv---dQMTRLATE-LDEF 686  Echinococcus ...
5N7I_A         78 KKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDK 112 
EFC44015      294 ----RKTDVQTLTKKFNAMHEELDCIKKLLLEYAT 324  Naegleria gruberi
ERN06594     1195 RLC--GPGHIRMKKVFIVLHKELQLLRQRIEEYAA 1227 Amborella trichopoda
XP_006651113 1133 HES--GTRHKLMKKVFGLLHEELQTIKRRIKDFAD 1165 malo sina
XP_002276282 1216 SQC--STRHKRLKKIFVVLHEELKNLKQRIKDYAL 1248 wine grape
XP_004236392 1191 RKC--GPRHVRLKKIFIVLHEELKHLKQMIKDFAV 1223 tomato
KRH44202     1000 RRC--GPRHKRLKKIFVVLHTELENLKGRIKDFSN 1032 soybean
NP_566681    1155 CKY--GERHKRLKKVFVVLHEELKHLKQRMRDYAS 1187 thale cress
Q9N554        627 AHFEKDPEFMKARQRHTDLRSKLNVLKTRIGSWEK 661  Caenorhabditis elegans
CDS40880      687 LNCMRKPERRDDEVRLLVMTFKLQHLKQRLATFAS 721  Echinococcus multilocularis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap