Conserved Protein Domain Family
DPM2

?
pfam07297: DPM2 
Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localization and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2.
Statistics
?
PSSM-Id: 399936
View PSSM: pfam07297
Aligned: 44 rows
Threshold Bit Score: 76.1094
Threshold Setting Gi: 443899477
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCG83770       5 IDKLIGLLMLFVASFVFVYYTMWVMIMPFVDQGHPLHELFPAREWAIRIPVILLLTGGTLVGSFLGFVMVKSAQKK 80  Taphrina deformans ...
CCX10833       2 laaLAGISMILVATAVFLYYTIWTLFMPFVDENIELHNFFPPRVWAIRIPLAIVLVGVAVVGSFLSMVMIKAGQKK 77  Pyronema omphalodes...
EEQ86421       2 FGRLIGLGMLLVATAVYLYYTAWTLLMPFVDDGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVVMIRSNRKK 77  Blastomyces dermati...
CBF89801       2 LGQLVGSAMLLAATAIFLYYTAWTLLMPFVDPGHPLHAFFPPRVWAIRIPVFLTLLGSAVVGTFIGIVMINSNKKK 77  Aspergillus nidulan...
EGP92181       7 LDRLVGLAMLILASAVFLYYTVWTLLMPFVDDSHPIQSLFPPRVWAIRIPVILILLGGAVVGSFLSVVMIRSNRKK 82  Zymoseptoria tritic...
EMT64072       2 LDKIVGLAMLVAASVVFTYYTIWTLLMPFVDDDHPLQNFFPPRVWAIRIPVIIILLGSAVVGSFLGMVMIRSNQKK 77  Fusarium oxysporum ...
GAA94533       4 GDRLVGATLLITAIATFTYYTAWALFTPFFPDDHPIQQLFPARVWAIRIPLVLLIVGLSGAGAFVGLVLVRTGRKK 79  Mixia osmundae IAM ...
XP_003036139   4 SDSLIGGAMLFTAVFVFVYYTIWAILLPFFDPESPIHSYFPAREWAVRLPAFILVVGLSAVGAFIGNTILKENRKK 79  Schizophyllum commu...
CCF53279      14 SNRIVGSLILFTALSLFGVYTLWAIVLPFLPDDSPIHTWVPDRRWTITIPSIVLVVGLSTVGIFIGLLLREDAKqd 89  Ustilago hordei
KDE08176     255 TDKLVGGLMLSTAIVVFTYYTIWTLFTPFLPSSSPLINYFPPREWAIRIPALLMLSGLMTIGAFVGLILVKSSRQn 330 Microbotryum lychni...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap