Conserved Protein Domain Family
DUF1449

?
pfam07290: DUF1449 
Protein of unknown function (DUF1449)
This family consists of several bacterial proteins of around 210 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399931
View PSSM: pfam07290
Aligned: 33 rows
Threshold Bit Score: 185.128
Threshold Setting Gi: 569540801
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Goettingen:OSB_06380     10 ALPFSIALAVVVGLFILEIIGSLLGATVLGLGGEGpdldidadfdlsadididaPDLDMDvvadi---gdtptTPAGLLG 86  Octa...
WP_013819051              9 SLPFTAALVLVLLIGIVETLAVLSGLTLSGWLDTLf------------------IDSLPG-------------ATDSWLG 57  Meth...
EZQ01101                 10 NLFFSISICLMFFIGILEVFLLITGLSSQGFLEQFlpssld-------sspemiVDHQSS-------------IWIQFLD 69  Acin...
PRJNA293381:AMD27_11685  10 NLFFSVSLCLMLLLGLVECILLIVGASSQGFLDQFipdslfd-----thhpdfnVDADHG-------------LWIQFLD 71  Acin...
KQY90549                  9 TLPFGVAVALIVAIALLEGLGMLVALSPSNVIDDLl------------------PHAVPEs------------GLDRVLG 58  Pelo...
WP_007850992             11 TWPFGVAFALIVGIALIEGLGMLVSLSPSNWLDDLl------------------PDIDGDt------------GLDRVLG 60  Acid...
WP_054125066              9 NLPFGVGFALIVGLALIEGLGMLVSMSPSNYLDDWl------------------PEIDGNs------------GLDRVLG 58  beta...
WP_058721528              9 NLPFGIAFAMIVGIALLEGLGMMISMSPSNWLDDWl------------------PEAGHDg------------ALDRVLG 58  Pauc...
WP_055086979             10 AVPFSIALTVVLGLFFLEVVGLVLGGTLLGLGGESpdidvd-------adfdltADVDPGgvtsadvpndmsaAPSDILT 82  Jann...
WP_058311788             10 ALPFSVALAVVAGLFILEIIGALLGATILGIGSDGpdidvdadfdlsadldldaVDLDTDldta-----eigaAPSGLLG 84  Phae...
Goettingen:OSB_06380     87 WLGARDVPFLIWLVSFLTLFGLSGLVVQSIATRTIGIPLFTWLAVAVALVPAITVTRIIANWVALIMPKTETSAMRTRFL 166 Octa...
WP_013819051             58 WLHVGRVPVLVLLVTWLTAFSIIGVSFNALAYGLFGLYVYPLLSVPAALVFSLPLVRLAGAGLAKILPKDETSAVLLETL 137 Meth...
EZQ01101                 70 WLYLGRIPVLIWLIIFLTTFSIVGFLAQSIIHHVFGSFLTVWLITPLVLVVCMPFVRLFSRWIVKIIPKDETTAIHSDDL 149 Acin...
PRJNA293381:AMD27_11685  72 WLCLGRIPVLIWLIIFLTTYALFGFITQGIFFHFTESYFPLWIIAPATLFLCMPIVRVIASIFVKILPQDETTAIHSDEL 151 Acin...
KQY90549                 59 WLHLGRVPALVLLLLFLLGYALFGYALQKVAFNLLGGFLPAWLAGLLAVPPGLATVRGLGSLVAHIIPRDESSAVSEQSL 138 Pelo...
WP_007850992             61 WLYIGKVPSLVLLVLFLTGYAIFGYSLQKVAHGLLGGYLPVWLAGLVAVAPGMATVRSLGSLIAHIIPRDETSAVSEMSL 140 Acid...
WP_054125066             59 WLHVGKVPVLVLLLLFLGGYTVFGYSMQLVANGLFGSYLPAFLAGLLAVPAGMATVRGLGALIAHIIPRDETSAVSEQSL 138 beta...
WP_058721528             59 WLHLGRVPALVVLLLFLTGYALFGYSLQLVSRGLVGHYLPAWIAGLAAVPAGLTTTRALGALVAHIIPRDESTAVSAQSL 138 Pauc...
WP_055086979             83 WIGARDVPVLIWLVSFLTMFGLFGLLIQLLAMTTIGAPLYTVLAVIIAAIPALAVTRVIANWVALIMPKTETSAMRTRFL 162 Jann...
WP_058311788             85 WLGARDVPFLIWLVSFLTMFGLSGLVIQSVANSVFGSSFAVWIAVAIAMVPAIASTRFIANHVALIMPKTETSAMRTRFL 164 Phae...
Goettingen:OSB_06380    167 GGSRGTITQGTAMRGKPAEVKIKDRHGNIHYLRVEPLDDDGVFPEGSDVTLI-RKRGDKFFVI 228 Octadecabacter temper...
WP_013819051            138 VGRTALVINGTARVNYPAQAKVKNEHGQTFYVRVEPEQETQTFSAGQSVLLIkQISGTRFLAI 200 Methylomonas methanica
EZQ01101                150 IGLRAEIILGTARLHYPAQAKLKDRFGQTHYILVEPEADEI-FVQGQQVLLT-QRSFKGFQAI 210 Acinetobacter sp. Ver3
PRJNA293381:AMD27_11685 152 IGLTAEIILGNAKPNYPAQAKVKDQHGLTHYVMVEPATEIT-LLQGQSVILT-HKTKIGFQAI 212 Acinetobacter sp. TGL-Y2
KQY90549                139 VGRSGVISGGQARRGLAAQARVRDAFGRTHYLMVEPDLDDEVFEEGAQILIV-RKAGAFYRCI 200 Pelomonas sp. Root1444
WP_007850992            141 IGRPGVVSAGAARRGLAAQARVRDAHGRTHYLMVEPDLDDEVFDEGAQILIV-RKIGAFYRCI 202 Acidovorax sp. CF316
WP_054125066            139 VGRVGVIITGTARRGLGAQARVKDSHARSHYVMVEPDLDDEIFEEGAQVLIV-RKAGAFYRCI 200 beta proteobacterium ...
WP_058721528            139 LGRIATVYAGHARRGLAGQARVRDEHGRVHHLLVEPDLADDVFEEGSELLLV-RKNGAIYRAI 200 Paucibacter sp. KCTC ...
WP_055086979            163 GGHRGTITQGTARRGQPAEVKIKDRHRNIHYLRVEPLEDDGVFPQGSDVTLI-RKRGDKFFVI 224 Jannaschia donghaensis
WP_058311788            165 AGHRGTITQGTATRGKPAEAKIKDRHGNFHYLRVEPLEDDGVFPKGSDVTVI-RKRGDRFFVI 226 Phaeobacter sp. CECT ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap