6VBU


Conserved Protein Domain Family
BBL5

?
pfam07289: BBL5 
Bardet-Biedl syndrome 5 protein
BBS5 is part of the BBSome complex that may function as a coat complex required for sorting of specific membrane proteins to the primary cilia. Mutations in the BBS5 gene cause Bardet-Biedl syndrome 5.
Statistics
?
PSSM-Id: 399930
View PSSM: pfam07289
Aligned: 38 rows
Threshold Bit Score: 361.124
Threshold Setting Gi: 123426741
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VBU_5         7 LWEDRDVRFD--VSSQQMKTRPG-EVLIDCLDSVEDTKGNNGDRGRLLVTNLRIVWHSLALPRVNLSIGYNCILNITTRT 83 
ESN92694       6 LWQDRETRFD--VNPSLLNLVRG-EKVILELNAVEDSKGNTGVLGSAILSNLRFIWHSQKFPKVNISLGHNCILSVNCIH 82  Helobdella robusta
Q3SCX0         5 FLYDRCIHFD--IAAAKLNMQKG-EKTLFLWKDVEDIKGNPDQLGSLVISNTRILWWSERNNSVNLSIGLGTIFHIEQKV 81  Paramecium tetr...
XP_003110993  12 IWQDREIRFD--VDHKLLRMAKG-EFAVAKVEHVEDTKGNNGDKGIMKVTNLRLIWYAMNMPRINISIGWNTITGTQSKT 88  Caenorhabditis ...
XP_001746720  12 pWRDREVHFD--IGNKLIALTRG-EFVIDHLDQVEDTKGNNGISGTLTVTNLRLIWTNKKRSNINLSIGLRNVVSIQVKP 88  Monosiga brevic...
EGD78614      17 pWRDHEVRFD--SIATHMQPGPG-EVIIDSLSNVEDTQGNNGVRGKLVVTNLRIMWHAIKKPSVNLSIGLFCISQISVKM 93  Salpingoeca ros...
CAM37441      25 FWQDREIHFG--VSAAALKLRENtEHIYAAFNHVEDKKGNEGHSGTLLVTNLRLIWSSARRQAVNISIGYYCVQKLTVQE 102 Leishmania braz...
Q4GYG4        18 LLLDRTIRFDtsLSELQEQTSRG-ERILMRLSPVEDTKGNSGKEGVLYVTNLRFMWHSSHRVRNNLSVGYYGVYNMSVQM 96  Trypanosoma brucei
EAO00071      18 FWFDREFRYNlpDEGLVVQTARG-EVLLSKLSPVEDTKGNNGEEGVLYVTNLRCIWQSKVNPHKNLSVGYYGIQGIEVRE 96  Trypanosoma cruzi
Q4QGM5        25 FWQDREIHFD--AATPVLKLRENtEHVYATFDNVEDTKGNNGCPGTLLVTNLRLIWRCKQRPNVNLSIGYYCVHKLTVQE 102 Leishmania major
6VBU_5        84 ANS---KLR-GQT-EALYVLT--KCNSTRFEFIFT----------------------------------NLV--P-GSPR 119
ESN92694      83 SQS---KIK-SSS-DSVIISA--ECSGEKYEFVFS----------------------------------NLI--V-DGPS 118 Helobdella robusta
Q3SCX0        82 TNN-------NRTfGTLFRTK--LATGQKYEFHFS---------------------------------------S-QDKK 112 Paramecium tetr...
XP_003110993  89 STSlaaRNR-GGTnEAIYILAklSSTTTKFEFIFT----------------------------------ATS--PnSHSK 131 Caenorhabditis ...
XP_001746720  89 VES---KLL-GNV-KALWIMC--KHKQSKYQFIFT----------------------------------HLV--P-GSPR 124 Monosiga brevic...
EGD78614      94 VES---KLKgGRT-QALTLVC--KFKKMRFSFVFT----------------------------------YLV--P-SSPR 130 Salpingoeca ros...
CAM37441     103 MAS---KLV-GGTtECVTLSA--KYGTRRFQFIFLegngvvgasq---------------ggspssfrrRPSkgTaTDQS 161 Leishmania braz...
Q4GYG4        97 VET---RLR-GHA-EALRITA--RYGSNRFEFFFT-----------------------------------------HPSE 128 Trypanosoma brucei
EAO00071      97 ANL---RLR-GTT-EVLYITS--RFGSSRYEFVFT----------------------------------QLMrkNcQ--- 132 Trypanosoma cruzi
Q4QGM5       103 AES---KLA-GRMtECITLGS--KCGASRFQFIFSvahdvgdigsgsaaststsggaaaqrdcenrsrrRPSkgTgGHQR 176 Leishmania major
6VBU_5       120 L----YTSLIAVHRAYETSKMYRDFKLRS-ALIQNK-QLRLLPQENVYNKINGVWNLSSD---------------QGNL- 177
ESN92694     119 L----YTSLNSVLRAYVSSKMYREVKLRG-SLFKDD-ALKTYPHEEIFREIHGVLNLSND---------------QGNI- 176 Helobdella robusta
Q3SCX0       113 L----YESLINIQRLYTQTMLHREIKVQF-AMISQK-KLNTSEKEQIINQYANTISVAND---------------QQDVs 171 Paramecium tetr...
XP_003110993 132 L----FNTISSINRAYETTKMYRELKMRG-IFIREDgTLRILPQEYIVEIVAGAWNLSTEtvclrldfliyikliQGSL- 205 Caenorhabditis ...
XP_001746720 125 L----FTTVPAVHRAYASSTLYRDVKIRApALIRDG-AIEPLPQEEVYDALEGVSNLSGE---------------KGEL- 183 Monosiga brevic...
EGD78614     131 L----FTIIQAVHRAYDSTRLYREVVVRSsTLVSDD-RVAVLPDEEIFDTLDGVWNLSGD---------------KGEL- 189 Salpingoeca ros...
CAM37441     162 L----YCTIRAVWNAYESTRVYRELRVRS-AVVQHG-NLLLLDGESVISRTAGVSSVSKD---------------EGRL- 219 Leishmania braz...
Q4GYG4       129 DrrsrLSAVRLVWRAYDTTRIYREVRLRS-CAVRDG-ELLLLKGERLVTRVKGVSNVSSE---------------QGHI- 190 Trypanosoma brucei
EAO00071     133 -----LFIVPTVWRAYESSRAYRELRMRS-SLVRDG-DVILLPGEQLFTRLEGVTNVSED---------------KGII- 189 Trypanosoma cruzi
Q4QGM5       177 L----YATIRAVWNAYESTRVYRELRVRS-AVVQHG-NLILLDGENVISRTSGVSSVSKD---------------EGHL- 234 Leishmania major
6VBU_5       178 GTFFITNVRIVWHANMnDSFNVSIPYLQIRSVKIRDSKFGLALVIESSQQSGGYVLGFK-IDPVEKLQESVKEINSLHKV 256
ESN92694     177 GVMIVTNVRVVWYALSnQIYNVSIPYLQIIDVKVKDSKFGRAIVFEITKQGGGYILGFR-IDPVEKLQAVFREVRKLYKM 255 Helobdella robusta
Q3SCX0       172 GTLIFTNVRFVWYSATnDLFNISIPWIAVKKISKKTTKGLYTMIIETYQEFGGYYVGYRnID----MDSMIKECNKLHAF 247 Paramecium tetr...
XP_003110993 206 GVFVITNIRIVWYAELnTGYNVSVPYLTLYSARVRESKFGMALVLETTASSGEYVLGFK-VDPPERLQNLVKTIQTLHKA 284 Caenorhabditis ...
XP_001746720 184 GRFIVTNIRFIWYSEQnPLYNVSCPYYTVSHIGGRQSKFGSAVVVKLAGAAGALNLGFR-CDPPKRMAKLLKMMQRLHRV 262 Monosiga brevic...
EGD78614     190 GTMVVSNIRCIWYSDLdPRFNVTIPYCMMSRIAIRNSKFGKALVVKTAKAARSLTIGFR-IDPADRLQRVAQKMERLHRV 268 Salpingoeca ros...
CAM37441     220 GTLVVTNIRVVWFAAV-ELFNVSVPYLQFVGLRSQMSKFGQALVIETSSYAGNFVLGFR-IDPEEKLNEMYTEISTLWRT 297 Leishmania braz...
Q4GYG4       191 GTFFTTNLRLLWCSDTsAEFNISIPFLQIAAMRIQDTEFGLSLMVETTASVDSYVIGFR-VDPVARLDQLFKECTSLLNA 269 Trypanosoma brucei
EAO00071     190 GVFFTTNVRIVWFAQHaPHINISIPILQLTALRMRPTKYGAAILLETSSYAGSCLIGFR-VDPVDRLRGLFRECVSLWKA 268 Trypanosoma cruzi
Q4QGM5       235 GTFIVTNIRVVWFAAA-EFFNVSVPYLQFVGLRSQMSKFGQALVIETSSYASNFVLGFR-VDPEEKLNEMYAEISSLWRT 312 Leishmania major
6VBU_5       257 YSANPIFGVDYEMEEKPQPLEALTV-----------------------------------KqIQDDVei--------dsD 293
ESN92694     256 FTHNPNYGIECSVENSMAESKQNSS-----------------------------------K-FSDDAev--------yeD 291 Helobdella robusta
Q3SCX0       248 HTENPIYGIEIQEKQQPTVQ----------------------------------------R-FDEKVqv--------vqS 278 Paramecium tetr...
XP_003110993 285 QSMKPIFGVTFIKEKSEKTERKEVT-----------------------------------K-EDEEIdiidtneddveiE 328 Caenorhabditis ...
XP_001746720 263 YHITPLLGIEAEVEEQPTEDLMPEN-----------------------------------V-PDDDVe----------iV 296 Monosiga brevic...
EGD78614     269 YHASPIYGVHVDVETAEGEGEGAGEm---------------------------------eT-EDDDIe----------iI 304 Salpingoeca ros...
CAM37441     298 WTTRPLLGMKVALHDNMSTAVVPGAlesegeapgsdsrhg-----edahrgacspqsrrqT-EGQYV------------L 359 Leishmania braz...
Q4GYG4       270 FKTHPNLGVAVTLQDVTAGNDDEVSamlgaaega------------------svgpqpreL-DGENV------------V 318 Trypanosoma brucei
EAO00071     269 WSARPVLGIAVTLEDAPPREEGDANmkhinddggdg-------------pfsllssqhrkL-DGENV------------V 322 Trypanosoma cruzi
Q4QGM5       313 WTARPLLGMKVELHDDTAKAMVPESlgvggggpggksgsaehphsgripgaagdaqherqM-EGQSV------------L 379 Leishmania major
6VBU_5       294 --DHTDAFVAYF---ADGnkq-----qdREP--VFSEELGLAIEKLKDGFTLQGLWEV 339
ESN92694     292 hgEHSDVFALYC---VDGgra-----tnREP--VYNEELGLLIEKLPDGYTLSDLWDV 339 Helobdella robusta
Q3SCX0       279 iyN----QAARYqane---------nndIQNdiAYSPELGLAIQKLPADAKLSEFWNI 323 Paramecium tetraurelia
XP_003110993 329 knIRPDPFAAYFdgqhs------ttdekKLP--VLNQEIGLSMEPIRNGFTLQDLWAI 378 Caenorhabditis remanei
XP_001746720 297 qqDKVDTMAAYFssdSSGtt-------gRDP--VFSAELGLAIEPLPAGVSLQDLWRV 345 Monosiga brevicollis MX1
EGD78614     305 qrDDFDVLAAY----ANGrlgqeasednKMP--VYSEELGLAIEPLLPGFTLDALANI 356 Salpingoeca rosetta
CAM37441     360 reAPMEAFAAYY---ADDgqk----gadRRP--VYEPSIGLAVEKLRKGATIQSLWDT 408 Leishmania braziliensis MHOM/BR/75/M2904
Q4GYG4       319 qeVATDAFAAYYvgigq-------kgadRKP--EYNASIGLAVEKLRNGVTLQDLWNV 367 Trypanosoma brucei
EAO00071     323 tqVETDAFAAYYadvgq-------kgtdRRP--EYDASIGLAVERLRTGVTLRELWTV 371 Trypanosoma cruzi
Q4QGM5       380 qeAPTDALAAYY---AAGgrk----gedRRP--VYEPSIGLAVEKLRKGTTIQSLWDT 428 Leishmania major
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap