Conserved Protein Domain Family
BCHF

?
pfam07284: BCHF 
2-vinyl bacteriochlorophyllide hydratase (BCHF)
This family contains the bacterial enzyme 2-vinyl bacteriochlorophyllide hydratase (EC:4.2.1.-) (approximately 150 residues long). This is involved in the light-independent bacteriochlorophyll biosynthesis pathway by adding water across the 2-vinyl group.
Statistics
?
PSSM-Id: 399926
View PSSM: pfam07284
Aligned: 30 rows
Threshold Bit Score: 175.109
Threshold Setting Gi: 501501143
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CT1421        4 YTPEQLEKRNASKWTTVQAILAPIQFLIFLAGLTVTYLYSQGIwvTDFWWVTFFVALKTFMLVLIFVTGGFFELEVFGKF 83  Chlorobacul...
jgi:Cphamn1_0939   4 YTPEQLEKRNASVWTTTQGILAPIQFVVFLAGLVVTLLYKTGIvvDDFSWVTIFVVLKTLIFILIFVTGAFFEKDVFDEY 83  Chlorobium ...
jgi:Paes_1533      4 YTPEQLEKRNASVWTKVQAILAPLQFILFLAGLTVTWLYKEGIwiEDFSWVTIFVILKTLMLVLIFVTGAFFEKEVFDEY 83  Prosthecoch...
jgi:Ppha_0981      4 YTPEQLERRNASVWTKVQGILAPIQFVMFLAGLTVTWLYQSHNgiDNFAWITFFVTLKTLMLVLIFVTGGFFELEVFGQF 83  Pelodictyon...
jgi:Ctha_2718      4 YTPEQLRKRNNSVWTKVQLYLAPIQFVVFIIGVILTVMYYHGAl-EDFSIVTWALLIKTLFLVVLFVTGAFFEKEIFDIW 82  Chloroherpe...
Q8KBL0            37 YTPEQLAKRNASVWTDIQIILAPIQFFIFLGGITLNTLYYFNLagIDFYWISIAILFKTLFFAILFITGMFFEKEIFNHW 116 Chlorobacul...
Q3AQ29             4 YNPEQLAKRNASVWTDIQIILAPIQFFFFIGGLTVTILYANDLfpGGFYWVSLAILFKTLFFALLFITGMYFEKEIFNQW 83  Chlorobium ...
WP_011745822       4 YTPEQLSMRNASVWTDIQIILAPVQFLIFIAGVTITTLFANGIlvNGFYWVSLAILFKTLFFAILFITGMFFEKEIFNQW 83  Chlorobium ...
jgi:Cphamn1_0268   4 YTPEQLAKRNSSVWTDVQLILAPIQFFVFLAGVGVTFLYYQNNeiFSFYWVSIAILFKTFLFALLFITGAYFEKEIFNKW 83  Chlorobium ...
WP_011744105       4 YTPEQLAQRNTTVWTDVQLILAPIQFVFFLIGVGVTYLHYINPdiIAFFWVDVAILFKSFLFALLFFTGAYFEKEIFDKW 83  Chlorobium ...
tigr:CT1421       84 AFAHEFFWEDFGSAIAMIVHISYFILFFwIKPAEHILILTAYLAYLSYLVNAAQFVIRLLL 144 Chlorobaculum tepidum TLS
jgi:Cphamn1_0939  84 VFAPEFFWEDVGSTIAIIIHISYFVFFS-MGMSETILIWTALMAYLSYLINAAQFLIRLIV 143 Chlorobium phaeobacteroides BS1
jgi:Paes_1533     84 AFAPEFFWEDVGSAIAMVVHISYFILFF-MGLDEQILILTALLAYLSYLINAAQFVIRLIL 143 Prosthecochloris aestuarii DSM...
jgi:Ppha_0981     84 AFVHEFFWEDFGSAIAMVVHLSYFILFF-MGLDESTLIWTALLAYLSYLVNAAQFVIRLLL 143 Pelodictyon phaeoclathratiform...
jgi:Ctha_2718     83 VFSPEFLWEDIGSSIATTVHFLYFILAY-MGKSEDVLVWTAFAAYFSYVVNAIQYLVRIFL 142 Chloroherpeton thalassium ATCC...
Q8KBL0           117 IYSKEFLWEDVGSTVAAFFHLLYFVMAW-MEYPEHVLVVEAYIAYLTYVLNALQYLVRIIL 176 Chlorobaculum tepidum
Q3AQ29            84 VYSKEFLWEDVGSTVAAFFHLLYFVLAF-AGYPRDILILDAFLAYFTYVLNALQYLVRIIL 143 Chlorobium chlorochromatii CaD3
WP_011745822      84 VYSKDFLWEDIGSTVAALFHLLYFVMAY-LGYSQEVLIKEAYLAYLSYILNAMQYLVRIIL 143 Chlorobium phaeobacteroides
jgi:Cphamn1_0268  84 IFSKEFLWEDIGSVTAGAFHLLYFVMAY-LGASEDVLVWEAFLAYFTYVVNALQYLVRIVL 143 Chlorobium phaeobacteroides BS1
WP_011744105      84 IFSREFLWEDIGSVTAGAFHILYFILAF-TGASREVLVWEAFLAYFTYIANAMQYIVRILL 143 Chlorobium phaeobacteroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap