Conserved Protein Domain Family

pfam07280: Ac110_PIF 
Per os infectivity factor AC110
This family consists of several Baculovirus proteins of around 55 residues in length. Family members include Autographa californica nuclear polyhedrosis virus (AcMNPV) Per os infectivity factor AC110, which is required for oral infectivity. It may play a role after occlusion-derived virions pass through the host's peritrophic membrane.
PSSM-Id: 148722
Aligned: 23 rows
Threshold Bit Score: 38.3016
Threshold Setting Gi: 75565423
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q4KSY2     6 ALLVVVFVVFLTVLVILSVNKIQLRQMLYYQYKYIPKPLIRFV 48  Chrysodeixis chalcites nucleopolyhedrovirus
Q91BD2     7 VLVIVLTVCFVTMLFVLRTNRRHVEKILYYQYNYIPKPLISLV 49  Spodoptera litura nucleopolyhedrovirus
O55575     6 VLIVVLFVVFVTILFVLRLNRQQVAKVLYYQYNYIPKPFISFV 48  Leucania separata nucleopolyhedrovirus
Q9YMM1     6 VLLVTTFLVCAFLLFALATNEKQVRKILYYQYKYIPEPLISLV 48  Lymantria dispar multiple nucleopolyhedrovirus
Q77K55     7 VFILLSFIFALGALYLLRQNKRDLRRQLYYQYKYIPEPLVSLV 49  Helicoverpa armigera nucleopolyhedrovirus
Q80LL5     7 VLMLLLFVYSIFIISILINNKRNIHDTIYRQYNYIPETLLSTV 49  Adoxophyes honmai nucleopolyhedrovirus
Q2NNY8     8 TFLIIIFLYAIYFCVVIIVNNKRVQRNLFYQYNYIPASLLNTV 50  Hyphantria cunea nucleopolyhedrovirus
ABI13892   8 IFLILVFLYAMYFCVFIIVNNSRVKRDLFYQYNYIPAALLNTV 50  Anticarsia gemmatalis multiple nucleopolyhedrovirus
ACQ57286   8 IFLIIVFMYAMYFCISIVVNNGRVQRDLFYHYNYVPDTLLNTV 50  Bombyx mandarina nucleopolyhedrovirus
A0EYY7     6 VVLFVIFALCLTVLFTLRLNKNQMRQLIYYQYNYIPEPLISLV 48  Ectropis obliqua nucleopolyhedrovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap