Conserved Protein Domain Family
DUF1442

?
pfam07279: DUF1442 
Protein of unknown function (DUF1442)
This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 115904
View PSSM: pfam07279
Aligned: 4 rows
Threshold Bit Score: 335.336
Threshold Setting Gi: 75174940
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9SI67   1 MKLIWSPETASKAYIDTVKSCENLGTPGAAELVAAMAAGWNANLIVETWSEGETIAISVGLNIASRHTNGRHICIVPNAR 80  thale cress
O22136   1 MKLVWSPETASDAYIDTVKSCKSDKESGVAEFLSATAAGWNARLIVETWSRGDPITTSVGLAVAATHTGGRHVCIVPDEQ 80  thale cress
Q9LZY5   1 MRLVWSPETASNAYIHTVRSCKSYRDSSVAEFLSATAAGWNTRLIVETWSRGDPIATSVGLAVAAIHTCGRHVCIVPDEE 80  thale cress
Q9LNB3   1 MKLVWSPETASKAYIDTVKSCENLETPDAAELIAAMAAGWNVKLIVETWSEGDAIASSIGLNVASKHANAKHICIVQNSR 80  thale cress
Q9SI67  81 SQTAYLQAMAEQSCS-NLpeTIImneeGEELEHTMQTLQGIDFLVVDWDQKDFAaNVLRNAVFGSRGAVVVCRSGYRRST 159 thale cress
O22136  81 SKLEYVLAMRGFVTT-EV--VVV----GESVENTMEEFPGVDFLVVDSKRREFV-RTLRFAKLSNKGAVLVCKNAMHRAI 152 thale cress
Q9LZY5  81 SRSEYEAVMRGAVTS-DSteVMV----LDSAEDVVERISGVDFMVVDSKRHEFV-NALGLAKTSKMGAVLVCKNATLKSI 154 thale cress
Q9LNB3  81 SESAYLQAIQESSSPlNFpeTIV----AEEPGKAMKKLQGVDFLVVDWRNKEFAaAALKNAAFGNRGAVVVCRNGYS--- 153 thale cress
Q9SI67 160 SCFSWTKAF-SDRNVVRTVTLPVSGGLEIAHVAAARSSGKSDnnsNKRKWIKHFDQRSGEEHVIRK 224 thale cress
O22136 153 SGFKWHDVLkRGTRVVRSVFLPVGSGLDIVHVGATGRGDSRN---LRSRWIRHVDHLSGEEHLFRR 215 thale cress
Q9LZY5 155 PGFKWQGLLrRGTRVVRSVFLPVGRGLEIVHVGASGGGNGLRk--IPSRWIKHIDPRSGEEHLFKR 218 thale cress
Q9LNB3 154 ---SLRRVL-RDRKVVRTVTLPVTGGIEIAHVAARNSGKSGN---NKRRWITHVDQRSGEEHVFSI 212 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap