Conserved Protein Domain Family
Orthoreo_P17

?
pfam07272: Orthoreo_P17 
Orthoreovirus P17 protein
This family consists of several Orthoreovirus P17 proteins. P17 is specified be ORF2 of the S1 gene and represents a nonstructural protein which associate with cell membranes.
Statistics
?
PSSM-Id: 148716
View PSSM: pfam07272
Aligned: 6 rows
Threshold Bit Score: 150.398
Threshold Setting Gi: 108948269
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q84143     1 MQHLRHTTFDVRRFE---FSPTVLEECLTPSFTAITDSDPVRYFNIELPSTHRLLPWLPALLSQ--SCSVHVSLTRRFSL 75  Orthoreovirus
ABL96274   1 MQSLRRTVFNVERFE---FSPIVFSEWVSPSFTAVTASDPVKYFNIELKSTHPLCSSICDLLSR--PCEVHVSLVRRFAL 75  Avian orthoreovirus
Q6T383     1 MQWLRHTTFEVQRFD---FCPISLRELATPSFTALVGTDSPQYFSIELSHSHPLYSQLTNLLSQ--PCRVHVRLIRRFAL 75  Avian orthoreovirus...
ABG24270   1 MDQSR--SFAVRWFDdglFTP-------QPIVCAALFNDSIA--EILINRSHPKFFVLSNYLADrwSIVVHVKLRRRYLL 69  Avian orthoreovirus
Q69C26     1 MSGRSRRTLPVSDCS---FYGPWIISGTYPVVSLICFREITYYINVDIPLDHPQRVVLPHLVAD--PVVWHVQLINRRAT 75  Pulau reovirus
Q9J1B1     1 MSIQPHLVFRMCESS---FYEPWVRSGYRSEISFICRRELTYYINVHIPLDHPQRSVACALSQT--PVAWHVSLLRRRSY 75  Nelson Bay orthoreo...
Q84143    76 YSTLSDICEYDCKLLPSVNAIVLNPVLDLPSSIVIHWDGRINSTAAKRSRGIDTVIDFERDYKSWRFDSYP 146 Orthoreovirus
ABL96274  76 FSTLSSICEYDCALFGLSDAIYRLPSGSRTSRLVVHWDGRSNSVTAKRSRGTDTLLDFEREYKLWRFGADT 146 Avian orthoreovirus
Q6T383    76 YSTLSSICEYDCALLLSPHAIIPLPTSNQRSYLVVHWDGGSQSIAAKRSRQLDTVIDFEHDYKSWRFDSSL 146 Avian orthoreovirus strain R...
ABG24270  70 S---RSICTFDCSFLDVE------VSTTSTSRVVVHYDPITQSASAKRGRDIDPISEFELEYRAWRFSDDT 131 Avian orthoreovirus
Q69C26    76 DSFKPYFCELDCVLIRVTP-----LTSHNRSHVIIHYSPFAQSPAAKRSYRFD--HDDDPEHK--RFA--I 135 Pulau reovirus
Q9J1B1    76 DPSLPDFCELDCVLRHIRPIPRRLVSRGFSSHVVVHYDRTTQSPAAKRGCSLD--FDDEPEHK--RFA--I 140 Nelson Bay orthoreovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap