Conserved Protein Domain Family
DMP1

?
pfam07263: DMP1 
Dentin matrix protein 1 (DMP1)
This family consists of several mammalian dentin matrix protein 1 (DMP1) sequences. The dentin matrix acidic phosphoprotein 1 (DMP1) gene has been mapped to human chromosome 4q21. DMP1 is a bone and teeth specific protein initially identified from mineralized dentin. DMP1 is primarily localized in the nuclear compartment of undifferentiated osteoblasts. In the nucleus, DMP1 acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the early phase of osteoblast maturation, Ca(2+) surges into the nucleus from the cytoplasm, triggering the phosphorylation of DMP1 by a nuclear isoform of casein kinase II. This phosphorylated DMP1 is then exported out into the extracellular matrix, where it regulates nucleation of hydroxyapatite. DMP1 is a unique molecule that initiates osteoblast differentiation by transcription in the nucleus and orchestrates mineralized matrix formation extracellularly, at later stages of osteoblast maturation. The DMP1 gene has been found to be ectopically expressed in lung cancer although the reason for this is unknown.
Statistics
?
PSSM-Id: 399917
View PSSM: pfam07263
Aligned: 15 rows
Threshold Bit Score: 154.278
Threshold Setting Gi: 1033406970
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011230561   1 MKTSILL-MFLWGLSCALPVTRYQNTESESSEEWKGHLAQTPTPPLESSESSEESKVSSEEQ---ASEDPSDSAESKEGL 76  giant panda
XP_003469412   1 MKTVILL-ALLWGLACALPVARYQDTASESSEEWTGHLVSSPTPSV-GNESSQESKVSSEEQ---ANEDLSDSPETAEDL 75  domestic guinea...
EHB12356       1 MKTSILL-MLLWGLSCALPVARYQNTESESSDEWKGHLAPSPAPPVENSESSEESKVSSEEQ---ANEDPSDSTETEEDL 76  naked mole-rat
O55188         1 MKTVILL-VFLWGLSCALPVARYHNTESESSEERTGDLAGSPPPPT-NSESSEESQASPEGQ---ANSDHTDSSESGEEL 75  house mouse
XP_001515945   1 MKTAFLLfICLWSLSWALPVARYQNTESESSEEWKGHLQRVRDRTTESSESSEESKDSSEEQ---VSEDNSDSTESEEDL 77  platypus
Q4Z8Q3         1 MKTSILL-MLLWGLSCALPVARYQNTESKSSEERKGQLAQTPAPPLESSESSEESKLSSEEQ---AHEDPSDSTESEEHM 76  pig
XP_007496039   1 MKTPFLL-IVFWGLSCALPVTRYLNTDSESSEELT-----VRR--AESSESSEESKDSSKEQmneSKKDYSDSIESEEDL 72  gray short-tail...
XP_021576845   1 MKTSILL-ICFWGLSCALPVARYQNTETESSEEWKgylaqsptpptens---esseeskvsseeqANVDPSDSAELEDDL 76  thirteen-lined ...
XP_017202907   1 MKTSILF-MFLWGLTCALPVTRYENTETESSEEWKDPLAPPPTPPL-------------------VSKDSRDTTDSEEAL 60  rabbit
XP_023369186   1 MKTSILL-MFLLGLSSAFPVTRYQNNESESSEEWKGHLAQVSTPPL-------------------ANEDPSDSTESEEEL 60  small-eared galago
XP_011230561  77 --NDHQYMHRPADGLPRNGGKGGDDKDDDEDDSGDDTFGNDDNGPGPEKRQ-GGNSRHKSNEDSADTTQSGEDSALQGED 153 giant panda
XP_003469412  76 tsDDDHYVSRPAGGLARSAGREGDDKEDDEDDSGDDTFGDEDNSLGPRKDReGGISRLDSGEDSADTTQSREDSASR-ED 154 domestic guinea...
EHB12356      77 tsDDGHYVSGSDGGLSRSAGKEEDDKEDDEDDSGDDTFGDEDNGLGPKEGQeGGISRLGSEKDSAGTTQSREDSASR-ED 155 naked mole-rat
O55188        76 gyDRGQY--RPAGGLSKSTGT-GADKEDDEDDSGDDTFGDEDNDLGPEEGQwGGPSKLDSDEDSTDTTQSSEDSTSQ-EN 151 house mouse
XP_001515945  78 -----HRLYKPAMGPTKSIMKEADGKDDDEDDSGDDTFGDEENGQASIQRQeEESPFVGAGDDNT-VGDDSEDYA----D 147 platypus
Q4Z8Q3        77 glDGHQYSHRPAGGLAVSGGKEGEDKDDDEDESGDDTLGDDDSGPGPEE----SNSRLRSGEDSADTTQSREDSAPQGEV 152 pig
XP_007496039  73 glTDQESVYLQSDSSLKSGIKE-DDKNDDEDDSGDDTFVDIDNGQGSMERH-------QQEDDDSDTTLSNENSTADGED 144 gray short-tail...
XP_021576845  77 gsDDRQYVYRPAGGLSRSTGKE-EDKDDDEDDSGDDTFADEDNGPWPEERTgGGISR-ADGDDSADATRSSEDSTSP-ED 153 thirteen-lined ...
XP_017202907  61 isDDGQYLYRTAGGFSKS------DKEDDEDDSGDDTFGDEDNGPGPKERQgGGNSELGSEEDSADNTQSRED------- 127 rabbit
XP_023369186  61 asDDRQDVHRPAGSLSSSAGIQGDDKDDDEDDSGDDTFGDDDNGPLSEERQ-GGNSRLGSDEDSGDTTQSSEESVPQAED 139 small-eared galago
XP_011230561 154 ------SAQDTTSESRDLDHEDEVNSRPERGDSAQESDSEELWVGGGSEGD-SSHGDGSEFGDEEMQNDDPDIIRSDRGN 226 giant panda
XP_003469412 155 ------STEHLASDSRELDGEDGV-----------DSKSEEHWEGGDSEGD-SSHGTGLEFHDNGMQNDDPDSTRREGGS 216 domestic guinea...
EHB12356     156 ------SIQYPASDSRDLDGEDRV-----------DSESEEHWVGGGREGD-SSHGDASEFHDDGMQSDDPDSTRSEGGS 217 naked mole-rat
O55188       152 ------SAQDTPSDSKDHDSEDEADSRPEAGDSTQDSESEEQRVGGGSEGE-SSHGDGSEFDDEGMQSDDPESTRSDRGH 224 house mouse
XP_001515945 148 ------TQRDYS--SQNLDEGEDVSHAADSGASDGDGQSRE-------NGE-EHDSDSQEFDDDEMQGDDPDSFGSDNSN 211 platypus
Q4Z8Q3       153 ------SAQDTTSESRGLDNEDEVDSRPEGGDSTADSESEEPWVGGGSEGE-GSHGDGSEFDDEGMQNDDPGTFRSEGSN 225 pig
XP_007496039 145 gnhnvvSDESSQSESRSLEEEENESHEVD----VHDSKSDEHNVEVGSEKSySSSSDESALDEEGMQGDDPDTIMSEISN 220 gray short-tail...
XP_021576845 154 ------SAQDTTSDSRDLDHEDDVGSRVEGRDFAQESESEEDWVGGGSEGE-SSHGDGSEFDDEGMQSDDPDSTRRDRGN 226 thirteen-lined ...
XP_017202907 128 ------SAQDTTSDSRDLDHEGVVHSRP-------DSESEEHWVGGGSDGE-SSHGDGSEFDDEGMQSDDPDSIMSERVK 193 rabbit
XP_023369186 140 ------SAQDVTSESRDLDNE--VDSRPEGGDSTPDSESEEHWLGVGSDGG-RSHGDGSEFDDEGMQSDDPDSIRSERGS 210 small-eared galago
XP_011230561 227 SRMNSASVKSEESkGNSDEQ-ASTQDSGDSQSVEYPRRKIFRKSRIS--EEDDIGELDDNNTMEEIKSDSTENTNSKETG 303 giant panda
XP_003469412 217 SRMDSTSVKSKESqG-VLKQ-EGTQDSGDKQSVGSPSRKFFRKSRIS--EEDDRDDLEDSNTVEDLRSDLTDSTDSQEDS 292 domestic guinea...
EHB12356     218 SRMDNVSVKSKEFqGDSKKE--GTEDSGDKQSAESPSRKFFRKSRIS--QEDDRGDLEDSDTMEDLKSGSTESTNSQEDS 293 naked mole-rat
O55188       225 ARMSSAGIRSEESkG-DHEP-TSTQDSDDSQSVEFSSRKSFRRSHVS--EEDYRGELTDSNSR-ETQSDSTEDTASK--- 296 house mouse
XP_001515945 212 SSMSSDSLNSKESsQENSEQ-GSRQDSNDSQSVGQSSRKWLKKAGISeeEEDDSGEQNDSNSMEERDSHSTEDSSSREAS 290 platypus
Q4Z8Q3       226 SRISTVNLKSKESkGKDEEK-ASTQDSGESRSVGYASRKFFRKSRIS--EEGGRGELEDENMM-EVKSDSAE------AH 295 pig
XP_007496039 221 SRMTGHSVNLKKKiHKTRHQdGNRKDSDVSQLVGQFGRKSFQKAHSS--EEDDWDENNESNTMEETMSDSTEKRQSSENG 298 gray short-tail...
XP_021576845 227 SRMSSAGVKSKESkR-DNEQ-VSAQDSGESPLVEHSSRKFSRKSRIS--EEDGGGELNGGYTTEEVKSDS---------- 292 thirteen-lined ...
XP_017202907 194 ARISSAGVRSKESnG-DSRQ-ASTPDAGQSRSVEYPRRRFFWKSRIS--QEDDRHELEDSNTQEEVE-DSTESPDSRDAG 268 rabbit
XP_023369186 211 SRIKGSTA--------NSEQ-PSPEDSGESQAGPRPGRTAFRKSRLS--PE--------AAAPEEMQSDSAEDADAGEAG 271 small-eared galago
XP_011230561 304 LSQSR--------ENSESESLEESEEKQSPE--DSQNVQDPSSESSQEIDQPSQEN-----SSESQEEV-VSESRGDNPD 367 giant panda
XP_003469412 293 PGQ----------EDSKSDSQEDTSESQSHE--D-EDEQDTSSESSQEVDTPSQES-----SSESQEEVmAAESRGDNPD 354 domestic guinea...
EHB12356     294 PDQSR--------EDSKSDSQVDSSESQSQE--DGEDLQEPSSESSQEVDLPSQES-----SSESQEGV-VGESRGDNPD 357 naked mole-rat
O55188       297 -------------EESRSESQEDTAESQSQE--DSPEGQDPSSESSEEAGEPSQES-----SSESQEGV-TSESRGDNPD 355 house mouse
XP_001515945 291 PGQSE--------ENSKSKSHEDS-GSRSREgaDSRGSRDL-SSSKDHSKGSSQETvlkqkSSKSHEDS-EVTSRGDNPE 359 platypus
Q4Z8Q3       296 LSQSW--------EHRRRESQQESEENESPE--EGQHVQDLSSESSQEVDLPSQEN-----SSESQEEG-VGEPRGDNPD 359 pig
XP_007496039 299 --QSN--------ENSKSKSQEDS-NSQSQE--DSQTVRDLSSESRPHDSDESYEK-----QSKSKEEN-ENVSRGDNPD 359 gray short-tail...
XP_021576845 293 --NSKeadlgqsrEDSKSESQEDSKESRSQE--DSENAQDPSSESSQEADLASQES-----SSESEEEV-ASESRGDNPD 362 thirteen-lined ...
XP_017202907 269 LSRSR--------E--------DSRESQSQE--DSNNEQDPSSESSQEADLPSQES-----SSESQEEG-LSESRGDNPD 324 rabbit
XP_023369186 272 LRRSR--------EDSRHESQEDREENESWE--DSRNEPEPSSESSQEADLPSEES-----SSESREEA-AGESRGDNPD 335 small-eared galago
XP_011230561 368 -NTTS---HS-EDQEDSDSSEENSLNKTSSSESESTEEQADSESNESLKDSEESPEFTEE-NSSSQ-EGLQSHSASAESQ 440 giant panda
XP_003469412 355 -ATS---------QPDSDSSEEDSLNTFSSSESESREQQADSESNESLRLSEESQESSEDdHSSSQ-EDLQSWSTSTESQ 423 domestic guinea...
EHB12356     358 -ATS---------QEDSDSSEEDSLNTFSSSESESREQQADSESNESLRFSEESQESPEDdSSSSQ-EGLQSQSRSTESH 426 naked mole-rat
O55188       356 -NTSQ---AG--DQEDSESSEEDSLNTFSSSESQSTEEQADSESNESLSLSEESQESAQDgDSSSQ-EGLQSQSASTESR 428 house mouse
XP_001515945 360 pN-------EdGDEVDSDSSQESSLSKSSQSESESRESQEHSKSSESSRQSEESRESSEEkSSSSH-EGLLSHSRSSSKE 431 platypus
Q4Z8Q3       360 -NITS---HSkEDLEESDSSEE-SLDKPSNSESQSREDPADAESKESLLSSEESPESTEEeNSSSQeEGLQAHSPSAETQ 434 pig
XP_007496039 360 sDGKSvglSEdNKEDSSNSSEEDDLNTSSKSDSESGEAQSDSESNESESPSVESKESSEE-NSSNQ-EGFQSQSSSTESQ 437 gray short-tail...
XP_021576845 363 -NVSR---AS--DQEDSDSSQEDSLNTFSSSESESREEQADSESNESLKLSEESPESTEDeNSSSQ-EGLQSQSTSAESQ 435 thirteen-lined ...
XP_017202907 325 -ATTS---ST---EEDSDSSQEDNLSVPSSSESQSREEQADSDSNESLKSSEESPETTEEeNSSSQ-EGLQSQSESAESP 396 rabbit
XP_023369186 336 ------------DVANRDSSEEGGLTASSSSESESGEDQADGESSESLQSSEESPESAEEgNSSSQ-EGFRSHSASAESQ 402 small-eared galago
XP_011230561 441 -----------SEEsqseqdSQSEED-DaSDSQDSSKSKEDSNSTESKSSSEED-GQSKNTEIESRKLTVDTYHNKPIGD 507 giant panda
XP_003469412 424 -----------SQE------SSSRED-TdSNSQDASWSKEDSNSTESTSSSEED-WLPKNMEAESRKLTVDLYHNKPIGD 484 domestic guinea...
EHB12356     427 -----------SQE------SHSGED-TnSDSQDSSQSKEDSNSTESTSSSEEN-GQPKNMEVENRKLTVDSFHNKPIGD 487 naked mole-rat
O55188       429 -----------SQEsqseqdSRSEED---SDSQDSSRSKEESNSTGSASSSEED-IRPKNMEADSRKLIVDAYHNKPIGD 493 house mouse
XP_001515945 432 d----------SAEssseqvGTKESDsEeSESQENSTSKRDSKSTESQSSSEEDaSLSKSIELESRKLMLDAYHNKPIGD 501 platypus
Q4Z8Q3       435 -----------SQEsqseqdSPSEED-DaSDSQDSSKSKE-SNSTESTSSSEEE-GQAKATEIESRKLTVDAYHNRPMGD 500 pig
XP_007496039 438 svskedsgessSEQlqeeenSQSEEDa--RALQENSKLKENESSSESRSVSNEE-SLSRSIEVESRKLIVDTYHNRPTGD 514 gray short-tail...
XP_021576845 436 -----------SDEsrseqdSQSEEE-PdSDSQDSSRSKEDSNSTESTSSSEED-GQPKNMEMDSRKLTVDAYHNKPIGD 502 thirteen-lined ...
XP_017202907 397 -----------SEEsqseqdSQSDEG-AgSDSQENSKSKEDSNSTESMSSSEED-GQARGMDMESRKLTVDTYNNKPIGD 463 rabbit
XP_023369186 403 -----------SEE-----------D-RsSDSQDSSRSKEDSDSTESTSSSEEH-GQSKTVEIESRKLTVDAYHNKPIGD 458 small-eared galago
XP_011230561 508 QDDNDCQDGY 517 giant panda
XP_003469412 485 QDDNDCQDGY 494 domestic guinea pig
EHB12356     488 QDDNDCQDGY 497 naked mole-rat
O55188       494 QDDNDCQDGY 503 house mouse
XP_001515945 502 HDDNDCQDGY 511 platypus
Q4Z8Q3       501 QDDNDCQDGY 510 pig
XP_007496039 515 HDDNDCQDGY 524 gray short-tailed opossum
XP_021576845 503 QDDNDCQDGY 512 thirteen-lined ground squirrel
XP_017202907 464 QDDNDCQDGY 473 rabbit
XP_023369186 459 QDDNDCQDGY 468 small-eared galago
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap