2GKP


Conserved Protein Domain Family
CdiI

?
pfam07262: CdiI 
Click on image for an interactive view with Cn3D
CDI immunity protein
CdiI immunity proteins function as part of the bacterial contact-dependent growth inhibition (CDI) system. CDI is mediated by the CdiB-CdiA two-partner secretion system. Each CdiA protein exhibits a distinct growth inhibition activity, which resides in the polymorphic C-terminal region (CdiA-CT). Cells with the CDI sytem also express a CdiI immunity protein that blocks the activity of cognate CdiA-CT, thereby protecting the cell from autoinhibition. In many CDI systems the cdiBAI genes are followed by orphan cdiA-CT/cdiI modules, suggesting that these modules are exchanged between the CDI systems of different bacteria.
Statistics
?
PSSM-Id: 399916
View PSSM: pfam07262
Aligned: 9 rows
Threshold Bit Score: 184.899
Threshold Setting Gi: 81637138
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GKP_A             12 YWAGYKANERALIIQTWSGFGRYAPDHLYPPHILPLDTDNETLGTTVLQALANSRTFvyds-----pedQ-DFF-----D 80  Neisseria ...
WP_012072754        4 KQIFIEKTGKYISISSYWIGRISLLNTKQNLKYLAPDVSFSDFGVEIRKKLSESKII------------SeEFFiyhfnD 71  Actinobaci...
Q7N2L7              9 LNARVKFNGDFYSVQTYSGNGLLGADPSGSNYLLQPIVSDQELGKAVLDALSKSRVIpl--------dkYgDYF-----D 75  Photorhabd...
Q7N2L5              9 RNARCVFNGDFYSIISYSGYRSLNLDLLGGNHMLSPDISDEELGIVILDALSKSRLIdp----------ddNFF-----D 73  Photorhabd...
CCH:MU9_2489        9 LNASISFNGSYFYFLRMIDHGLLIPDYLFGNIIIPGDAVISSVGISLRQVLKKNEDInp--------eeN-YIF-----D 74  Morganella...
CCH:MU9_2488        9 LNARIGFNGDFYHVDTMSGHGILIVDNLFESCLLSKDTTAEMLGLCLKKCLKQSRIVdp--------gnY-DFF-----D 74  Morganella...
bbmufp:Hsero_4683   5 frATVYFNGDLYQIITMAQGMLDFADPDLSPQILMPTTTDAELGGALRLALSKSRQVtvp-------efQ-EIL-----K 71  Herbaspiri...
Q9CND5              4 YSVLIKKTEKFILVNYFLESVLSVLDPKQDINLLPPNTTYSALGKHIRENLSKSREIdfdelraimsldSdDIFl----- 78  Pasteurell...
Q9CND6              4 KFIFIEKTSKYISISSYWVGRINLLNTQQTLIYLNPNVMSSDFGKAIKEKLNESDLI------------SeDLFmfhfnD 71  Pasteurell...
2GKP_A             81 TEKIRQRYEDWVAKLCGNLGYKTRRALFKNXXSVDIWLHNGCLKISPSRHVKLEAWDAI---DADDVIL--SLDNSPEEI 155 Neisseria ...
WP_012072754       72 DAGLSLFNKNEEKKIMLSYGYKSVKAICKDAVYLTVSVIDNNLIIRPTHQDGLGTFTSVkdnVGNSVEFrySINLSDEEL 151 Actinobaci...
Q7N2L7             76 HDVNAEQYKNWITEMMGSYNYRSKRQLFKKMLSCGICMLDGQITIRPSCHEKLEGWSEDgisEADYVII--PADSSPAEV 153 Photorhabd...
Q7N2L5             74 NEKKAERYKEWVKLLMETYNYCSKRQLFKKMHNCGIQLLDGQITIRPSSHEKLEGWSGDgisVADYVVI--PADSSPEEV 151 Photorhabd...
CCH:MU9_2489       75 HKLNKENYEDNIKKLMGLCGYKNKKSLFKKMNKCLVKQVGNVIEIKPLNHIKLEAWDGDgisETDDVII--PVSASDEEL 152 Morganella...
CCH:MU9_2488       75 YKKVKERYEEWIKNIIQLRGYKNKKTLFKQMNTCNARQVGDLITIKPSNHIKLEAWDGDgisETDYVII--PVSASDEEL 152 Morganella...
bbmufp:Hsero_4683  72 SGIVQKNAKERQALIMQRHGYKNRKAMMRKMACCWITADKAKIEIKPTHHKNIDGYSGIsndGPEIIFI--STNSGDAEL 149 Herbaspiri...
Q9CND5             79 --------KSLEQKIKEEFSYKNKKEIYKNMDFLSVSIMNNIIIITPWHQDSLDGYTAIedeNRKWVRFeyPIDISDEEL 150 Pasteurell...
Q9CND6             72 NEGLSLFNKNEEKKVMSVYGYKSAKAICKDALFVTVLVINNSIVIRSTHQDGLGTFGTArdrYGKAIEFtySIDLSDEEL 151 Pasteurell...
2GKP_A            156 GAGLKLALSRC 166 Neisseria meningitidis MC58
WP_012072754      152 GKAVMDAFKHC 162 Actinobacillus succinogenes
Q7N2L7            154 GAALRLAFSRC 164 Photorhabdus laumondii subsp. laumondii
Q7N2L5            152 GAALRLAFSRC 162 Photorhabdus laumondii subsp. laumondii
CCH:MU9_2489      153 GNAVIEAFSRC 163 Morganella morganii subsp. morganii KT
CCH:MU9_2488      153 GNAVIEAFSRC 163 Morganella morganii subsp. morganii KT
bbmufp:Hsero_4683 150 GAALKEGFSRC 160 Herbaspirillum seropedicae SmR1
Q9CND5            151 GKVVMEGFKYC 161 Pasteurella multocida
Q9CND6            152 GKAVMDAFEYS 162 Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap