Conserved Protein Domain Family
DUF1435

?
pfam07256: DUF1435 
Protein of unknown function (DUF1435)
This family consists of several hypothetical Enterobacterial proteins of around 80 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399912
View PSSM: pfam07256
Aligned: 9 rows
Threshold Bit Score: 63.5209
Threshold Setting Gi: 123346433
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rahaq2_3940     17 MFGKRLTSGWGVLLPCALMPLLALTHMSLDQLRVLIVVAMLVTLGMLFHRTLRHYMLLPSFMALAGSLAAVTLNF 91  Rahnella aquat...
Q0WJN6               1 MLSRGMSSGWGILLPFTLLPVLGWVDISIGQLRILIVVAMLATVSMLYHVRLRHFLLLPSCLALLGGLVALMLMH 75  Yersinia pestis
goetting:EBL_c33830  1 MLQQQLRSGWGIILPAVLTAAGAIWGLSAAQWRVILVLGMLSTTVMLFNRHLRHYLLLPSGLTFAGGLMMALTll 75  Shimwellia bla...
P55914               1 MLQRTLGSGWGVLLPGLLIAGLMYADLSSDQWRIVILMGLVLTPMMLYHKQLRHYILLPSCLALIAGIMLMIMNL 75  Escherichia co...
Q8ZJW7               1 MLQRTLGSGWGVLLPGVIIVGLAFIGLSADALKLLIVSGLLLSALMLYHKQLRHFVLLPSCIALIGGMMLAMMNW 75  Salmonella ent...
wugsc:CKO_03427     14 MLQRTLGSGWGILLPGIFITGLAFAGLSIDAWKVLIVLGLLLTSLMLYHKRLRHFVLLPSCVALISGMVLVMMNL 88  Citrobacter ko...
CAX58102             1 MFGKKLDSAWGVLLPCAVMPLIALMKLSFSEWRVIMVIALLATVAMLYHKRLRHYLLLPSCLALAGGMAAISVNF 75  Erwinia billin...
WP_013316348        17 yfGKRLSSAWGVLLPAALMPLLALPELNLTHLKYICALAMLLTLSMLFHRRMRHYLLLPSCIALAGGLAALSLTL 91  Dickeya
Q6D981               1 -mgKHLSSAWGVLLPCAIMPLLALLNLNLTHLKVIIAVALLATLAMLFHQRLRHYLLLPSCIALAGGLAALSVMF 74  Pectobacterium...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap