Conserved Protein Domain Family
Cpta_toxin

?
pfam07254: Cpta_toxin 
Membrane-bound toxin component of toxin-antitoxin system
CptA is a family of bacterial proteins named for the member of this family, YGFX_ECOLI. YgfX was previously thought to be the toxic part of a toxin-antitoxin module along with the antitoxin, pfam03937 Sdh5. However, studies have shown that, YgfX interferes with correct cell division and morphology. Furthermore, the function of YgfX-SdhE as a TA system could not be demonstrated in either E. coli or Serratia sp. ATCC 39006. YgfX is predicted to have a short N-terminal cytoplasmic domain followed by two transmembrane helices (TMHs) separated by a short periplasmic loop and finally, a larger C-terminal cytoplasmic domain. The TMHs of YgfX are required for activity, but the sequence of the cytoplasmic 13 N-terminal amino acids is not essential. Furthermore, the amino acids W34 and D117 are not required for localization but are necessary for YgfX multimerization, interaction with SdhE, and YgfX activity. It is proposed that the formation of YgfX multimeric membrane-bound proteins are required to enable the interaction with the cytoplasmic SDH assembly factor SdhE. Another study has demonstrated that sdhEygfX (bicistronic operon) affects pig biosynthesis, directly or indirectly, at the level of transcription of the biosynthetic operon (pigA-O). It has also been suggested that, in addition to indirect transcriptional activation of pigA-O, YgfX might facilitate the formation of a terminal pig biosynthetic complex consisting of PigB and PigC.
Statistics
?
PSSM-Id: 399911
View PSSM: pfam07254
Aligned: 12 rows
Threshold Bit Score: 143.992
Threshold Setting Gi: 498302770
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002215144      1 MAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPW-PLG---YTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVR 76  Yersinia pse...
ACQ67306          1 MGQFQCKLQVSPFTKLFSFIVYTLLALITLLAPSgPKD---FIPFYLIIIIFLVFECVLSQKKIRSYQGKIIFMADNRLH 77  Candidatus H...
utah:Sant_0786    1 MALWRCDIRVSWRTQLCSLAFYGILIMLILLSPW-PEN---YGLVWLTLVLVVVFECIRSQRNIMSCRGELVLMSDSSIQ 76  Sodalis prae...
ACR70482          1 MALWRCNVHASWRTQVMFLLGHGALVLAILLAPW-PEN---YSVFWLILLVAVIFECIRSQRLIARNSGELQRLAPQVWH 76  Edwardsiella...
Q46824            1 MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPW-PLS---YTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLR 76  Escherichia ...
wugsc:KPN_03324   1 MVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPW-PLS---YTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLR 76  Klebsiella p...
IEC:ABF-0018058   1 MAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPW-PDG---YAPLWLGLVTLVVFGFVFSQRIIKTRQGEISLHGENQLH 76  Dickeya dada...
Q6D959            1 MAQWQCDLRVSWRMQLLSLVVHGLLVLLILLAPW-PDG---YAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLN 76  Pectobacteri...
WP_010616926      3 agRWQCDLRASRSARALNVTLFGLYGSLLLSCRW-PAG---WAWVQVAVLILLTLQCWRNARRLQQRCGALMLDDKGDWH 78  Plautia stal...
Q7N1C2            1 MVLWKCDLRVSWHTQLISTCVHGAIALIVLFAPW-PADdaiFWIFWLPLVLLIIASWGRSQKNIRKSQGLLVLLSDNKLQ 79  Photorhabdus...
CAR44059          1 MTLWKSHLTVSWFTQLFSTSVYVIFEIALLLYPW-PPG---FIYIWVPLLLLLILGWYFSQKNINKRKGDLVLLNGNRIQ 76  Proteus mira...
WP_004240903      1 MVLWKSVLRVSFNTQVFSTLIYGVLALSVLFAPW-PGR---TSFIWLPLTLLLIAGWGRTQYKISKRAGPASLQNQNRIL 76  Morganella
WP_002215144     77 WKRHEWTVVKPPW-ITRYGVLLHLQQTGGhATRKRLWLSADSMSEDEWRQLCLLL 130 Yersinia pseudotuberculosis complex
ACQ67306         78 WLEQNWLLIKKPWaLSRYGLLLFLKQEDT-NAQKNLWLLYDNMSEPEWRQLHQFV 131 Candidatus Hamiltonella defensa 5AT (...
utah:Sant_0786   77 WHREEWTFTRKAW-MLKGGVLLSLRKAGG-TRRRRLWLAADSMDGREFRHLRQLL 129 Sodalis praecaptivus
ACR70482         77 WQLREWRLARRPW-VSDLGALLILQSTHGtPCRRRLWLAADSMSREEWGQLRRAL 130 Edwardsiella ictaluri 93-146
Q46824           77 WQGQEWSIVKAPW-MIKSGMMLRLRSDGG--KRQHLWLAADSMDEAEWRDLRRIL 128 Escherichia coli K-12
wugsc:KPN_03324  77 WQNAEWEILGTPW-VINSGMLLRLRHVDT-RRGQHLWLAADSMDAGEWRDLRRLV 129 Klebsiella pneumoniae subsp. pneumoni...
IEC:ABF-0018058  77 WQQRDWQIVRRPW-LMRNGVLLSLRAVDG-KGHQRLWLASDSMGNEEWRLLRQLL 129 Dickeya dadantii 3937
Q6D959           77 WRQQEWQIVKRPW-LLKNGVLLALQSIND-KERQQLWLASDSMGDDEWRHLRQLL 129 Pectobacterium atrosepticum
WP_010616926     79 WRGERWQAQLQPD-WLPWGVLLVLRNRRG--QRWRLWLLHDSMPPDAWRALRArc 130 Plautia stali symbiont
Q7N1C2           80 WKKHEWQIIRRPW-LCRYGVLITAQSFYN-QKKIRLWVASDGMPQDEWRNINQLL 132 Photorhabdus laumondii subsp. laumondii
CAR44059         77 WKYHEWQIAKQPW-ISRFGAKITLDSILN-NKQITLWVAFDSMPENEWRNFSQLL 129 Proteus mirabilis HI4320
WP_004240903     77 WRKSEWEITKPPY-ITRLGIRLHLRSLTS-GRQKYLWIASDSVPKEAWSSLNQLL 129 Morganella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap