Conserved Protein Domain Family
Glyoxal_oxid_N

?
pfam07250: Glyoxal_oxid_N 
Glyoxal oxidase N-terminus
This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
Statistics
?
PSSM-Id: 399910
View PSSM: pfam07250
Aligned: 74 rows
Threshold Bit Score: 377.63
Threshold Setting Gi: 241934924
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH69372       1 MHMQVMYDNKVVIFDRTDFGPSNISLSGHRCRFNPRDLAL---KLDCTAHSVLYDLATDTFRPLTLRSDAWCSSGALTAS 77  soybean
EFJ28740      42 MHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTL---KHDCTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPN 118 Selaginella moe...
EDQ50675      51 MHTAVNFYDSVIFLDRTNIGLSEINFTNGYCRNNPQDRVL---KHDCSAHSVMLDPVSGKVRPLTIITDTWCSSGQFFAN 127 Physcomitrella ...
XP_002972039  53 MHTAVTHYGTVLLLDRTDIGASKISLTDNRCRRDAADKSL---QTDCSAHSVIIDVATAAVRPLTILTDTWCSSAQFTAN 129 Selaginella moe...
XP_009421296  54 MHTAVTRFGTVVLLDRTGIGASRLRLPRSRCRIDPGDSLLppgGKDCSAHSALLDPSSRRLRPLSVLTDTWCSSGQFLPN 133 wild Malaysian ...
XP_006850437  39 MHTAVTRFGTVVLLDRTNIGPTKLKLPRGNCRYDPRDATL---KLDCYAHSAIFDPASNQIRPLKILTDTWCSSGGFLPN 115 Amborella trich...
XP_003516307  53 MHTAVTRFNTVVLLDRTNIGPSRKLLPKGHCRSDKNDAVL---KLDCYAHSVHLDLATNQIRPLKILTDTWCSSGQFLPD 129 soybean
XP_002322929  35 MHTAVTRFNTVVLLDRTNTGPSRKMLRKGHCRLDPHDAVL---KRDCYAHSVLFDLQTNQIRPLMILTDTWCSSGQFLHD 111 black cottonwood
Q9M332        48 MHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPKDAAL---KRDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSD 124 thale cress
XP_002274763  48 MHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL---KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPD 124 wine grape
KRH69372      78 GTLLQTGGFNDGYTKLRSFTPCPsHntCDWLEHNNhNLSTSRWYASNQILPNGKVIVVGGRNSFTYEFVPKNQnDASSFW 157 soybean
EFJ28740     119 GTLLQTGGDFDGFFKVRYMTPCPnGgtCDWQESKTeFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRG---AGQF 195 Selaginella moe...
EDQ50675     128 GTLVQTGGDFDGMRKVRLLDPCGpDggCDWMESDTeNLKDKRWYSTNQLLPDGRQIVVGGIESYSYEFVPKRK-SREGSY 206 Physcomitrella ...
XP_002972039 130 GTLLHTGGDFDGNRKLRYFVPCPePgaCDWVESSDqSLKAGRWYATNQLLPDGRTIVVGGRDSFTLEFVPPSP--GDELV 207 Selaginella moe...
XP_009421296 134 GTLLQSGGDLDGLRKLRAFSPCPlAgsCDWLELDSpLLADGRWYATNQILPDGSVVIVGGRAAPSVEFYPPSR----PLR 209 wild Malaysian ...
XP_006850437 116 GTLLQTGGDLDGNRKVRLFEPCSsGsyCDWMEIPDyDLAVGRWYSTNQILPEGHVIIVGGRGTHTVEFYPPNM---GTIT 192 Amborella trich...
XP_003516307 130 GTLLQTGGDLDGLKKIRKFSPCD-DasCDWEELNDvVLAEGRWYATNQILPDGSVIIIGGRGSNTVEFFPPKQ---NVAV 205 soybean
XP_002322929 112 GTLLQTGGDLDGFKKIRKFDPCDiNgsCDWVELDDvELSEGRWYASNQILPDGSVIIIGGRGANTVEYYPPR----NGAV 187 black cottonwood
Q9M332       125 GSLLQTGGDKDGFKKIRKFEPCDpNetCDWVELQDtELITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRE---NGAV 201 thale cress
XP_002274763 125 GSLLQTGGDLDGVKKIRKFVPCGpHgfCDWEELKDvELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRK---GGAV 201 wine grape
KRH69372     158 FLPFLKLTRDPNrgeENNLYPFLHLLPD---GNLFIFANRNSILFDYTKNKILRNFPLIPGQEkRNYPSTASSVLLPLNl 234 soybean
EFJ28740     196 ELPFLKETNDPT---FNNLYPFLHLLPD---NNLFVFANRDSILLNYFTNTVLRRYPTLPGEP-RNYPSAGSSVMLPLDs 268 Selaginella moe...
EDQ50675     207 ELNFLNETKDAQ---NDNLYPFVHLLPD---GNLFIFANRDAILLDYRRHKVLRKYPTIPGEP-RNYPSAGSSVMLPLRh 279 Physcomitrella ...
XP_002972039 208 TFPFLSSTRDMQ---MDNLYPYVHLLPD---GNLFVFANRDSILYDYKRNAVLRKFPAIPGGP-RNYPSGGSSVLLPLSa 280 Selaginella moe...
XP_009421296 210 NFPFLATAEDAQ---MDNLYPFVHLLPD---GRLFVFANARSILYDVDSGDVVREYPELDGGP-RNYPSGGSSTMLPLDp 282 wild Malaysian ...
XP_006850437 193 ELPFLLEAEDAQ---MDNLYPYVHLLPN---GRLFIFANTKSILYDYNLNRVVHVYPELQGGP-RNYPSAGSSAMLALTp 265 Amborella trich...
XP_003516307 206 SFPFLSETEDTQ---MDNLYPYVHLLPN---GHLFVFANTRSVMYDFNRHVIVKEYPKLQGGP-RNYPSAGSSAMLALE- 277 soybean
XP_002322929 188 LFPFLADVEDKQ---MDNLYPYVHLLPN---SKLFVFANNKAVLFDHETNKVVKGFPPLDGGP-RNYPSAGSSVMLALE- 259 black cottonwood
Q9M332       202 PFQFLADVEDKQ---MDNLYPYVHLLPDddgGNLFIFANSRAVKYDHRINAVVKEYPPLDGGP-RNYPSGGSSAMLAIQ- 276 thale cress
XP_002274763 202 QLPFLSDVEDKQ---MDNLYPYVHLLPN---GHLFIFANNKAVMYDYTSNKVMLEYPPLDGGP-RNYPSAGSSVMLALE- 273 wine grape
KRH69372     235 tgltngqTRLPEAEVMICGG 254 soybean
EFJ28740     269 ------aNSFSNAEILVCGG 282 Selaginella moellendorffii
EDQ50675     280 ------dDDFTVAEVLVCGG 293 Physcomitrella patens
XP_002972039 281 ------aDGFTAVEVLICGG 294 Selaginella moellendorffii
XP_009421296 283 ------aDGYTRAEVVVCGG 296 wild Malaysian banana
XP_006850437 266 ------dNEHSTAEVVVCGG 279 Amborella trichopoda
XP_003516307 278 -------GDYSKAEIVVCGG 290 soybean
XP_002322929 260 -------GDYSTAVIVICGG 272 black cottonwood
Q9M332       277 -------GDFTTAEILICGG 289 thale cress
XP_002274763 274 -------GDYSMAIIVVCGG 286 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap