Conserved Protein Domain Family
Cerato-platanin

?
pfam07249: Cerato-platanin 
Cerato-platanin
This family contains a number of fungal cerato-platanin phytotoxic proteins approximately 150 residues long. Cerato-platanin contains four cysteine residues that form two disulphide bonds.
Statistics
?
PSSM-Id: 369288
View PSSM: pfam07249
Aligned: 4 rows
Threshold Bit Score: 204.341
Threshold Setting Gi: 312217431
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGZ74318  20 TVSYDTGYDDPNRSLTVVSCSDGSNGLITKYhwNFQNQVKNFPYIGGVEAVAgWNSPNCGTCWSVTYNGKTINILAIDHA 99  Neurospora tetraspe...
CBX97379  21 SVSYDTGYDDPNRSMGVVSCSDGPNGLMHRF--PTQGAIPNFPRIGGLSGIA-WNSAQCGSCHKITYNGKSIFVVAIDSS 97  Leptosphaeria macul...
O60022    34 SVSYDPRYDNAGTSMNDVSCSNGVNGLVTKw--PTFGSVPGFARIGGAPTIPgWNSPNCGKCYKLQYEQNTIYVTAIDAA 111 Aspergillus fumigat...
O74238    18 SVSYDQGYDDAGRSLTSVSCSDGNNGLITKYgwQNQGAVAGFPRIGGYSGIAgWNSAQCGTCYGITYNGNTIYVLAVDHA 97  Parastagonospora no...
EGZ74318 100 GAGVNLSKKAMNELTGGNAEQFGRVDAQVQQVALSAC--GL 138 Neurospora tetrasperma FGSC 2509
CBX97379  98 STGFNIGLTAMNELTNNQATSLGRIEAEVTNASPSDC--RI 136 Leptosphaeria maculans JN3
O60022   112 PGGFNIATSAMDQLTNGMAVELGRVQATYEEADPSHCasGV 152 Aspergillus fumigatus Af293
O74238    98 GDGFNIAKQAMDQLTNGQAAGLGRIDANYQQVATSNC--GL 136 Parastagonospora nodorum SN15
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap