Conserved Protein Domain Family
AATase

?
pfam07247: AATase 
Alcohol acetyltransferase
This family contains a number of alcohol acetyltransferase (EC:2.3.1.84) enzymes approximately 500 residues long found in both bacteria and metazoa. These catalyze the esterification of isoamyl alcohol by acetyl coenzyme A.
Statistics
?
PSSM-Id: 369286
View PSSM: pfam07247
Aligned: 7 rows
Threshold Bit Score: 481.597
Threshold Setting Gi: 74609131
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6FVS8  40 RMGHLENYFAIMQRQKLYTNFNMYGELNKEVTREQLAVAIRQILLRHPIMMQAIIPKKFPEHEEYYTSDDYYNTPFPEND 119 [Candida] glabrata
Q6XBS9  47 RMGSVEDLYAALNRQKLYRNFSTYSELNDYCTKDQLALALRNICLKNPTLLHIVLPARWPDHKKYYLSSEYYSQPRPKHD 126 Saccharomyces pastori...
Q6XBT1  23 RMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKLLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHD 102 Saccharomyces pastori...
Q6CJX7  18 RAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYPILATTIIPEYWNEKETYYTSEAFYNKPGLAED 97  Kluyveromyces lactis
Q6FND8   4 HLGGIEQYFYQRSSLNLHSCFSVGVELNSLPNRSDFICALRRVVNSHFQLYCNAYK----------SNNEVVVNP----- 68  [Candida] glabrata
Q6BRP8   9 KLGFLEKYYVCRNVEWYKEDICVTAQYNQHIDEVLLSNALRSLILKNTVFALNVYRDGDPQYDAKMNGDNFTVRP----- 83  Debaryomyces hansenii
Q09710   9 EAGRLEIYSVKRNVLNMFSIVIVSATYSISLDSTVLYPAVYHAIVNQPMLGARIH-------------NCHSKIP----- 70  Schizosaccharomyces p...
Q6FVS8 120 FLRVItSKIKLSDIIINEQSEdYGEIIDMILSEYKKNGYKFDAYMQELIGNIVIPIGNPNKPNWRLLCLPSAEGGGa-QW 198 [Candida] glabrata
Q6XBS9 127 YISVL-PELKLDGVILNEQPE-HNALMKQILEEFANSNGSYTAKIFKLTTALTIPYTGPTSPTWRLICLPEEDDTN--KW 202 Saccharomyces pastori...
Q6XBT1 103 FIKVI-SHLEFDDLIMNNQPE-YREVMEKISEQFKKDDFKVTNRLIELISPVIIPVGNPKRPNWRLICLPGKDTDGfeTW 180 Saccharomyces pastori...
Q6CJX7  98 YVSVV-DQLKLEDVIMNKQPE-HSKFYNEILNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKgaRG 175 Kluyveromyces lactis
Q6FND8  69 ----IgEPIKFDDVV-----------------DYMDWDTYGEEEINSVFRKYNFEYGVDK-PLWKVIVVPKA-------- 118 [Candida] glabrata
Q6BRP8  84 ----V-EKIAFSDVV-----------------SFKDIDELFGVVELNALSEEVSPVNDTR-PLWRLKVYKSSSSK----- 135 Debaryomyces hansenii
Q09710  71 IVKKL-KTIDLDKVV-----------------KYAD-DQKVDSFCNNALQNFKLCYDDETLPLWMVYVLND--------- 122 Schizosaccharomyces p...
Q6FVS8 199 KKFV-YISNHCCSDAISAVNLFQDIAENVSLIEQNSWav---pyADDVIVDY-----EQDVADIA-KLPAPITERVEY-- 266 [Candida] glabrata
Q6XBS9 203 KKFI-FVSNHCMCDGRSSIHFFQDLRDELNNIKTLPK-------KLDYIFEY-----EKDYQLLR-KLPEPIENMIDF-- 266 Saccharomyces pastori...
Q6XBT1 181 KNFV-YVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFdydeefiEDQVIIDY-----DRDYTEIS-KLPKPITDRIDY-- 251 Saccharomyces pastori...
Q6CJX7 176 FKDIlYITNHVTSDGTSGANLLEDLSIELGKFSGTNLq------QLEYLLHY-----GRDYEQLP-KLPDPIEEKVSYgv 243 Kluyveromyces lactis
Q6FND8 119 NKMI-FATDHLFFDGIATVLFWTELLKSLEELKQDNDl-----dVDEIIYRPggstdSIDQCHPYeKLPIPFSWKVKRpi 192 [Candida] glabrata
Q6BRP8 136 KQYVtFHCDHTFFDGLSAAQFHKDLIVEFGIYSGDAAl-----kFQETLFDY-----TEDKS----KLP-DILDSPDK-- 198 Debaryomyces hansenii
Q09710 123 KSELvFIYDHSLFDGGSGPLFHKYVLEGLQMSKTNFS--------------------SSTVPVSElPLPKNLEKLIDV-- 180 Schizosaccharomyces p...
Q6FVS8 267 RPPLSKLPKIMLVSFLKTALNFKSdalet------rcndeYSGEPETSAVQMGDVCYDSILNYTCEEVAVIRDRIKHNVH 340 [Candida] glabrata
Q6XBS9 267 RPPYLFIPKSLLSGFIYSHLRFSS----------------KGVCTRMDEIEKSDEIVTEIINISPSEFQKIRTKIKLNIP 330 Saccharomyces pastori...
Q6XBT1 252 KPALTSLPKFFLTTFIYEHCNFKTss-------------eSTLTARYSPSTNANASYNYSLHFSTKEVEQIRAQIKKNVH 318 Saccharomyces pastori...
Q6CJX7 244 NPSFIA---SFLLSQMGKKLLTKKw--------------dQPITRPIDASPASHMAH--IIKIDPTGMQKMRARVKDKLN 304 Kluyveromyces lactis
Q6FND8 193 VKALFTIAPGAVVSQDASIIQFDEykip--------edylKKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDCKQH-- 262 [Candida] glabrata
Q6BRP8 199 IVDLYNPGILFSLLAIVQSMLLPKwladgfwslfstnaeqKPLY-THLPVQKGAKSNQRHVNIKPDDVKRLRAFCRSQ-- 275 Debaryomyces hansenii
Q09710 181 HPSWFCLMKALWTN---SGLPFSKgf-------------rSPSYKGHAPV-RPFSSHTIFFSISNAVVKNIKQLSKNI-- 241 Schizosaccharomyces p...
Q6FVS8 341 GKCTVTPFIQAAFFVAMHQSRKLlgqkqgFKEWMSEWGVDMATPSSTRRYLPEDPEVRDMYKYGSNVGGIHYLYMISGMK 420 [Candida] glabrata
Q6XBS9 331 GKCTITPFLEVCWFVTLHKWGKF------FKPLKFEWLTDVFIPADCRSLLPEDEEVRAMYRYGANVGFVDFTPWISKFN 404 Saccharomyces pastori...
Q6XBT1 319 DGCTLTPFIQACFLVALYRLDKL------FTKSLLEYGFDVAIPSNARRFLPNDEELRDSYKYGSNVGGSHYAYLISSFD 392 Saccharomyces pastori...
Q6CJX7 305 GKATLTPFMQACWFVSCYEAGLF------DDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGTVVGGTNFNFLISSFN 378 Kluyveromyces lactis
Q6FND8 263 -HVSFTAYLTAVLYLALGKI---------PKEKYSGSTIKYEVPMNTRNRISNSGE--YSNSYGTFVAGGEF---IETLD 327 [Candida] glabrata
Q6BRP8 276 -STTLTPYITAIAMYALQETVF-------PVVSNSQCSFQVDIPIDGRRYFPDKAN---DTKYGIYVGA--FSCKMGPVS 342 Debaryomyces hansenii
Q09710 242 -DASFTSIFYSVFMLSIYY----------AIAKNGKVNLDMLIDVNARRFLPVAKQTMGNYVFSYVHHLNGF----QPSQ 306 Schizosaccharomyces p...
Q6FVS8 421 VeREETEKFWSLVEYYHDILLASHSNGDQTVGLGTLMLDV-IVDKKNVDKLIRDEYLYQK--RGGVIMSNAGYFHQ--DP 495 [Candida] glabrata
Q6XBS9 405 M-NDSKENFWPLIAHYHEVISGAIKDKKHLNGLGFNIQSL-VQKYVNIDKVMRDRALGKS--RGGTLLSNVGMFHQseET 480 Saccharomyces pastori...
Q6XBT1 393 IpEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQLDF-IVQNKNIDSLLANSYLHQQ--RGGAIISNTGLVSQ--DT 467 Saccharomyces pastori...
Q6CJX7 379 I--TSNQQFWDLTEYYQQWFTKTREEGLATKTFGTLFADF-VSKSNNLDKLIKQDMMHQR--RAFALLSNVGYRPQkaQE 453 Kluyveromyces lactis
Q6FND8 328 FeRDE----WELAQSIHKKIVE-----KSTTGVMDAINEArLLELVDAKKFMKMKFETTTgpSSTFEVTNLGFQNFsqNE 398 [Candida] glabrata
Q6BRP8 343 KsTGSYDDLKVPINTLTTQLSSSMADNSPFRYFG-------LLKYVNCWSFLASKIGQTDs-RLTLEVSNLGLHL---IS 411 Debaryomyces hansenii
Q09710 307 RqEDYKHTMVDLATEFSHRLKAALSNPREMSQQIG------LLSYIDIEDYLLKSCEKTR--GNTAEISNLGYFSF--PA 376 Schizosaccharomyces p...
Q6FVS8 496 AQAYHVTDLVFGQRPGALKFSFGVNVVSTNIGGMNLNVGMVRRTLRDRAEF------REFIGILDRVI 557 [Candida] glabrata
Q6XBS9 481 EHKYRIRDLAFGQFQGSWHQAFSLGVSSTNVKGMNILISSTKNVVGSQELL------EELCAMYKALL 542 Saccharomyces pastorianus
Q6XBT1 468 TKPYYVRDLIFSQSAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEW------ESFCKLFYQTI 529 Saccharomyces pastorianus
Q6CJX7 454 SNPFQLQDLIFSQAACEMPFVFSLCCVSTDIGGMSLTLTCCEESISQQQW-------HKICQVFEKNL 514 Kluyveromyces lactis
Q6FND8 399 HSKYTVTDAFFNEPQL-FTNLITYSVISTPSGGLNCSMAYPEKLDSILCNS---------VAFLKNKF 456 [Candida] glabrata
Q6BRP8 412 HDNWSIENLWFNQTNG-ILNHFCLSLIATESNGLNLLTSYLADLDMVQTSLrkl-viDEFMALFTTKL 477 Debaryomyces hansenii
Q09710 377 DSSVKIKNMAFAQPCSSLSAPFVLNVITVADGPCSFSLSIFDDGNTEQTHElaikirDKFLSILEKVS 444 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap