Conserved Protein Domain Family
Phlebovirus_G1

?
pfam07243: Phlebovirus_G1 
Phlebovirus glycoprotein G1
This family consists of several Phlebovirus glycoprotein G1 sequences. Members of the Bunyaviridae family acquire an envelope by budding through the lipid bilayer of the Golgi complex. The budding compartment is thought to be determined by the accumulation of the two heterodimeric membrane glycoproteins G1 and G2 in the Golgi.
Statistics
?
PSSM-Id: 369282
View PSSM: pfam07243
Aligned: 4 rows
Threshold Bit Score: 817.534
Threshold Setting Gi: 94449137
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABD38809  156 PHLRNRPGKGHNYidGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTI-IAKADPpSCDL--Q 232  Rift Valley fever...
P03517    282 PHAKNRVGTGMYK--YDENDDSGCRPIRYGVSCIGFDFMLKMDKYPFFNAFIGHKTPLESFADKI-IEKEEE-TCEI--G 355  Punta Toro virus
Q88304    304 THINNRPGLGKFAllTTGTEDEHCKKIDYGVTCSRFDHLKSLDRYPFFNSHYHHRALLEAHYDNI-VKVSSTiSCNE--T 380  Sandfly fever Sic...
ABF19086   56 NHLLNRPGNGAYT--LSDFAESTCT-LAYGSKCKSWEHQLDELSFPFFHSNLDKYSMLEAATETIpILNKSSaVCTIspS 132  Toscana virus
ABD38809  233 SAHGNPCMKEKLVMKTHCPNDYQSAHYLNNDGKMASVKCPPKYELTEDCNFCRQMTGAS-----LKKGSYPLQDLFCQSS 307  Rift Valley fever...
P03517    356 TNKEFKCFEERAYIKGTCPTNINAVHYIDNKGKLRYVKCKENLEMTEDCAFCRKIKKKAgqsvqVQKTSVPLQDAICQEN 435  Punta Toro virus
Q88304    381 KFKNAECSKEIRKLAYKCPRGVSGVIYADSQGEIGGIYCKENEELMENCIQCRKVQRKKp----qKGLLIQLQDMVCQPN 456  Sandfly fever Sic...
ABF19086  133 THSSNACGREASLMKKKCGSNMSAFFYVNLAGQITVVKCDTNHVLSNDCGNCISKTLSG------QKIYTPVQDMFCQKG 206  Toscana virus
ABD38809  308 EDDGSKLKTKMKGVCEVGVQALKKCDgQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFehkgQYKGTMDS 387  Rift Valley fever...
P03517    436 SDTYSGPKIPFKGVCKIGLIKYKECK-FKTSSYETVSFITLKEKGKIYIEHLMLKNIEVVTNVSFVCY----EHVGQDEQ 510  Punta Toro virus
Q88304    457 STDYTGPKQVLKGYCKIGMVDYRHCE-HFASMEEVVPFAIFKNKGKLYMDSMRIRNKDVLEKENFICYg---AKENADAD 532  Sandfly fever Sic...
ABF19086  207 WSESIPSTRYSKDLCSIGLHTVKECK-TGTTNFERVGFIVMKGR-KMYIEQMKMRSRQEFNEDQFLCY-------KSESS 277  Toscana virus
ABD38809  388 GQTKRELKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAFCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRE 467  Rift Valley fever...
P03517    511 EVEHRALKRVSVNDCKIVDNSKQKICTGDHVFCEKYDCSTSYPDVTCIHAPGSGPLYINLMGSWIKPQCVGYERVLVDRE 590  Punta Toro virus
Q88304    533 SSNHGGKVSVKVTECKNVDPSQNKICSGDNTFCSKFACHNELPEVHCEVAPGAGPIEVYYGGVWIQPMCLGYERAMVLRE 612  Sandfly fever Sic...
ABF19086  278 SGSSVKLKKVKVESCKGVTTSSASKCSGDEYFCSRYPCETANVEAHCILRRHSAVIEVNVNGVWVVPRCIGYEEVLVRRT 357  Toscana virus
ABD38809  468 LSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKISSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQS 547  Rift Valley fever...
P03517    591 VKQPLLAPEQNCDTCVSECLDEGVHIKSTGFEITSAVACSHGSCISAHQEPSTSVIVPYPGLLASVGGRIGIHLSHTSDS 670  Punta Toro virus
Q88304    613 MPPPVETSEDTCDSCYSECLDSHILVRSTGFMISGAVACSHGACASLTIVPSTEIMIPYPGMASSIGGDIGIHLSHDEVQ 692  Sandfly fever Sic...
ABF19086  358 SLKVEDTYSRECDTCLWECGKNKLIVKTHGPKIVYATACSHGSCKSVMQKPATFVYLPYPGNSEIVGGDIGVHMTEESSP 437  Toscana virus
ABD38809  548 VSSKIVAHCPPQDPCLVHGCIVCAHGLINYQCHTALSAFVVVFVFSSIAIICLAILYRVLKCLKIAPRKVLNPLMWITAF 627  Rift Valley fever...
P03517    671 ASVHMVVVCPPRDSCAAHNCLLCYHGILNYQCHSTLSAILTSFLLILFIYTVFSVTTNILYVLRLIPKQLKSPVGWLKLF 750  Punta Toro virus
Q88304    693 VSSHYRVHCEPKDPCVAHSCVICAEGIINYQCHTALSAFVVVTLVVLAVLMFLIVLKRCLVLFRVAPAILLVPFSWIVKL 772  Sandfly fever Sic...
ABF19086  438 SNIHMVAHCPAKDSCEVSSCLFCVHGLLNYQCHTLFSALLISTTVMSILTLLLLLVKGAKDLVKRLFYWLITPLCWLSVF 517  Toscana virus
ABD38809  628 IRWVYKKMVARVADNINQVNREIGWMEGgqlvlGNPAPIPRH--APIPR-YSTYLMLL-LIVSYAS 689  Rift Valley fever virus
P03517    751 INWLLTALRIKTRNVMRRINQRIGWVDH-----HDVERPRHR--EPMRRfKTTLLLTL-IMMTGGN 808  Punta Toro virus
Q88304    773 AFWTSRKLKISTERTIARINEEIGWRPEgaraaHRMRDRDRR---PIPR-SAVYLAIL-LLISVTS 833  Sandfly fever Sicilian virus
ABF19086  518 CGWMIRSWKKRVGSAISRTNDTIGWRDNsr-rgQDVERAQYTggAPGAKySFYGVMILgLLGEVHS 582  Toscana virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap