Conserved Protein Domain Family
DUF1430

?
pfam07242: DUF1430 
Protein of unknown function (DUF1430)
This family represents the C-terminus (approximately 120 residues) of a number of hypothetical bacterial proteins of unknown function. These are possibly membrane proteins involved in immunity.
Statistics
?
PSSM-Id: 369281
View PSSM: pfam07242
Aligned: 18 rows
Threshold Bit Score: 59.148
Threshold Setting Gi: 75542717
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q896P1       604 LLLLVSI-SIIIIQNIYTFFEQFKVYLAIKQLHGYKKLSNYKEYFYLILISWIIVATSVFISKIaiSKVILITSIVGLIT 682 Clostridium tetani
EFH95439     545 IINVFIL-LIATVFETIQYFSWNKKQLLLRKIHGYSLFSSNVRYLTISILLSIMLAYTTHILFG--SKILLFIIMSIAII 621 Staphylococcus ...
Q926X5       619 IILAISS-YSFMILLVLSYYRENLYKQLIYHVFGYSFWKSSKWFIISNLAVCAFSGVVTFIITK--EPIALYFSVVILLI 695 Listeria innocua
Q8Y3Q8       620 ILALCLC--SFMVLLVLSYYRENLYKQLIYHVFGYSFWKSSKWFIISNLFVSVFSGILIFILSK--EPVALYFSVVILII 695 Listeria monocy...
Q181M6       617 IIIIAISnLMITYNIVASYYERNKYKLYIKKIFGYSTTARSMLLIVSLILTNIIPIGIISTRVDl-SNNIILFGLLILVI 695 Clostridioides ...
EDK66688     166 IVGIASS-LLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR--DLVIGLLTLLVFLA 242 Streptococcus p...
WP_002935899 561 ILGIFTS-ILLFNTMNLLYFETFKREIAIKRIAGMRFIELHGSYLGEQVGSALVGMGLAMFMTK--SVIVSLGVVVALLI 637 Streptococcus suis
Q93MD9       619 VILLAVI-SIIILQNTSLYFNQNKNKIIVKKLHGYRLIYRYMNYFIMVLITWTCPLAIASLITK--DINIIYFTLILVVI 695 Clostridium per...
Q892J9       609 IML-----VIIVTQSVLSFFEQYKKIISIRSFHGYKSFDKYKEYLWIIIISWVAIVITSIILNKasLNIILSVALAGLIF 683 Clostridium tetani
Q9CJI4       565 VILIFLS---MILTTTVFYFETYKKKIAVKRLYGISFFVTYKTLFAIVLVQGSLYFAFALSQRD--VNITLEGLGIYFVL 639 Lactococcus lac...
Q896P1       683 ESIVSFLMLsYIQKKKIIEFIkKG 706 Clostridium tetani
EFH95439     622 QHLLQIAYI-KYLEKYFKDLM-RE 643 Staphylococcus aureus subsp. aureus MN8
Q926X5       696 ELCVIYFLKeKVINKDFKAIL-KG 718 Listeria innocua
Q8Y3Q8       696 ELCAIYFIKeKAIYKDFKAIL-KG 718 Listeria monocytogenes
Q181M6       696 EVIVSIVLDkIISNSSFNKII-KG 718 Clostridioides difficile 630
EDK66688     243 SAVLTLYRQaQKESRVSMTIM-KG 265 Streptococcus pneumoniae SP14-BS69
WP_002935899 638 NSWMLLNKQaKKAEKIQLSVL-NG 660 Streptococcus suis
Q93MD9       696 ELVFIIFNInSLEKKNLIKVI-KG 718 Clostridium perfringens
Q892J9       684 ECLLSIIFLnLISKNKFTEVM-KG 706 Clostridium tetani
Q9CJI4       640 EILIIILILlKLQKGLFLNVL-KG 662 Lactococcus lactis subsp. lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap