1UF2


Conserved Protein Domain Family
Phytoreo_S7

?
pfam07236: Phytoreo_S7 
Phytoreovirus S7 protein
This family consists of several Phytoreovirus S7 proteins which are thought to be viral core proteins.
Statistics
?
PSSM-Id: 399902
View PSSM: pfam07236
Aligned: 3 rows
Threshold Bit Score: 753.062
Threshold Setting Gi: 313471395
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UF2_K   1 MSAIVGLCLLSEKVVLSRSLTDEVSKLYKLNRGNVKEPRKYATERMSTQSKPVALQVPVSTIILDYKNEDFIKQNPTYSA 80 
A4PBP8   1 MTAIVCVSLLSEKAVLVKNLTDHVKAFYESIIGRFVSGPDTITEKRTMDSVIARKIVPSSTVILDGYGESFIRENPNATL 80  Rice gall dwarf virus
Q85435   1 MSAIVGLCLLSEKVVLSRSLTDEVSKLYKLNRGNVKEPRKYATERMSTQSKPVALQVPVSTIILDYKDEDFIKQNPTYSA 80  Rice dwarf virus (iso...
1UF2_K  81 MDIIGSPSNTAPQTAFQSIMPSLSALFNTPFIQGAFRHRIISSM-GPEISYLVMVIGPPSGFMDTPNVSSAQSSVHTVSN 159
A4PBP8  81 MDIVTSSNNTAPKTTYQSIMPAMSALLGVPYVQGAFRHGIISKHgGKKTSLIILVVAPPSGFIRAASVGSSSSVVEVDSN 160 Rice gall dwarf virus
Q85435  81 MDIIGSPSNTAPQTAFQSIMPSLSALFNTPFIQGAFRHRVISSM-GPEISYLVMVIGPPSGFMDTPMYRTVNHLSILMSN 159 Rice dwarf virus (iso...
1UF2_K 160 ADVDLNDIIAINSTMAKSTKLVSASTLQAMLVNDVYDRCMDLDGILLSQALPFFRNYVNVQSKGSLPPAVAACLNTPIKE 239
A4PBP8 161 ATIKLDDTVGINSAMIKNTKLVSAAGLTAMGIEEIPIKCNSLDSLIIGWSMKYFKGYVDGYKSGVRDQATTILLNTPFKD 240 Rice gall dwarf virus
Q85435 160 ADVDLIDIIAINSTMAKSTKLVFASTFQAMLVNDVYDRCMVLVGIFLSQALPFFRNYVNVQSKGSLPPAVAACLNTPIKE 239 Rice dwarf virus (iso...
1UF2_K 240 LF-SMGSGKREPlALEFRKDN---EGQCigIVLPKGHEGDTLSSRYPAVFINESEPFSDKERSELSElkrtdsDAYEKLY 315
A4PBP8 241 LFvENGAGRMLP-NDSFRVSEstiKNQV--IEMGEGTKPDALISTHGDVFIDSEAVFTSDEQEKYRK------DKDEEFF 311 Rice gall dwarf virus
Q85435 240 LF-SMGSGKREPlALEFRKDN---EGQClgIVLPKGHEGDTLSSRYPAVFINESEPFSDEERSELSKlkrtdpDAYEKLY 315 Rice dwarf virus (iso...
1UF2_K 316 SETISKHVSDGSYGNRVIISHKMSRLSNGGVKIIGRFKISdfntvkknlssrsgeidsaKEQWEALSGNGL--VTDSNIS 393
A4PBP8 312 KKCVCNHIIAGDYGNNVIIIENPPHSDVRGLGVKYSFQVN-------------------KPELDGTESNGIkyYSKDTPQ 372 Rice gall dwarf virus
Q85435 316 SETISKHVSDGSYGNRVIISHKMSRLSNGGVKIIGRFKISdfntvkknlssrpgevdsaKEQWEALSGNGL--VTDNNTS 393 Rice dwarf virus (iso...
1UF2_K 394 MLHDKILDTITSNKPGVVLrdgNKK------SENIVVCFKNGFPnKKHSLLQLTKNGISVVSldeLTDAGILVESTGPDR 467
A4PBP8 373 QIHDAILDVISDTNKSLLM---NSKpiertgKEAIAVCFKNGFP-KKFAMVEMEKNGVKIVG---MGDSPMLVLDNYPSM 445 Rice gall dwarf virus
Q85435 394 MLHDKILDTITSNKPGVVLrdgNKK------SDNIVVCFKNGFPnKKHSLLQLTKNGISVVSldeLTDAGILVESTGPDR 467 Rice dwarf virus (iso...
1UF2_K 468 VRRSPKvlANKLSS---FKGRKVTLDVDNMSTEALIQKLST 505
A4PBP8 446 LSRAEK--ANRKSSrakIDAPVVKIDTEDLDTNTLLDVIKK 484 Rice gall dwarf virus
Q85435 468 VRRSPKalANKLSS---FKGRKVTLDVDNMSTEALIQKLST 505 Rice dwarf virus (isolate Fujian)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap