3O0L


Conserved Protein Domain Family
DUF1425

?
pfam07233: DUF1425 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1425)
This family consists of several hypothetical bacterial proteins of around 125 residues in length. Several members of this family are described as putative lipoproteins and are often known as YcfL. The function of this family is unknown.
Statistics
?
PSSM-Id: 399900
View PSSM: pfam07233
Aligned: 42 rows
Threshold Bit Score: 91.1227
Threshold Setting Gi: 501640575
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3O0L_A        21 SFHSDVDVSAV-TTQAEAGFLRARGTIISKSPKDQRLQYKFTWYDINGATVEDEGVSWKSLKLHGKQQXQVTALSPNATA 99  Shewanella loih...
WP_012609967  52 DLTKQVRLVNP-KIAPLGKLKKGMVQLRNVSDNRLTLEYKFDWMDEDGFLI-GDGGIWERFSIGPGGVKTLQTVGKSPKA 129 Desulfatibacill...
BAM04638      50 GLASRVSVESV-QVARDLRLRRVAANLRNRTRDASFFQYRYRWFDKNGIQIDTPLDAWQTAHVLGGDTGQLVGIAPNAEA 128 Phycisphaera mi...
Q6AQQ7        39 KAAKYIEVSEIrGGRLPSGLFRARFIGDSTSSFKKEIKYRFVWLDCSGFELSGITSTWQSIRLSPKDEVRLQSVATSPRA 118 Desulfotalea ps...
Q3SFY8        39 GEMTYLKVAGL-RQAVRNELLTIQAEVANDNEGQQTLYYRFRWLDADGFSVWDD-EAWKPLLFHGKGRQVIQAVAPTPRA 116 Thiobacillus de...
BAF70800      38 YLEQKVEILDH-HTRYTNGLLEAMVQLHNKTKDFQDLEYRFIWLDSDGFVAEKE--PWQPLTLNGLETTQVNSIAHTPNA 114 Nitratiruptor s...
Q3IL01        44 ELGEKLAISDV-KTRQTNQLTDVVVTLASQYKKSQYLQYQFNWYDKDGFVIKGNHSPWQAITLFGFAQTQLSGLAPSPDA 122 Pseudoalteromon...
Q0VKU3        45 LLSSRISVVDL-RQKRVGDLLQVQAVLENDWKFQLDFQYKFKWFDADGFELEPEAQPWRQVVMAGRSQNSVQGVSPNPSA 123 Alcanivorax bor...
WP_014992396  45 LLASRLSVEEV-RRKRVNDLLYLQATLENGWKFELDFQYKIKWFDQQGFELAPESQPWRQLVMAGRSQANVQAVAPNPSA 123 Alcanivorax die...
WP_013136655  41 ALDSWLKLEKLnYFQKSDGFWVVQARFKNTTYMNRNVAYKIDWIDKNGFIVKTILSKWKMATVEENRDFTINGVSPSNQI 120 Arcobacter nitr...
3O0L_A       100 VRCELYVR 107 Shewanella loihica PV-4
WP_012609967 130 AQMQVTVR 137 Desulfatibacillum aliphaticivorans
BAM04638     129 VDWSLSIR 136 Phycisphaera mikurensis NBRC 102666
Q6AQQ7       119 SNFQVIIK 126 Desulfotalea psychrophila
Q3SFY8       117 TDFRLVVQ 124 Thiobacillus denitrificans ATCC 25259
BAF70800     115 TDFKFEIR 122 Nitratiruptor sp. SB155-2
Q3IL01       123 VTFSLAVR 130 Pseudoalteromonas haloplanktis TAC125
Q0VKU3       124 VRFEIWVQ 131 Alcanivorax borkumensis SK2
WP_014992396 124 VRFEIWVR 131 Alcanivorax dieselolei
WP_013136655 121 KDFVIRVQ 128 Arcobacter nitrofigilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap