Conserved Protein Domain Family
DUF1424

?
pfam07232: DUF1424 
Putative rep protein (DUF1424)
This family consists of several archaeal proteins of around 320 residues in length. Members of this family seem to be found exclusively in Halobacterium and Haloferax species. The function of this family is unknown. This protein is probably a rep protein due to conservation of functional motifs.
Statistics
?
PSSM-Id: 115861
View PSSM: pfam07232
Aligned: 2 rows
Threshold Bit Score: 623.274
Threshold Setting Gi: 140038
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P14321   1 MASQPeegfGERLRKEVTVDTSRGVRATSTAQAVENFEGWYADQRDTQMVVEEAtTGERVGFRTPNRFTPEYREMLYAKA 80  Halobacterium sp. GN101
P17565   1 MAKRD----GMKLRDELTFDTSRAVKAVSWGEAIDRFQSWYDDQRGTQIVVENE-LGETVGFDMPNRFTPEYREMLYAKA 75  Halobacterium salinarum
P14321  81 QSLERGLREEWGDLLHTAMVTLTASTTEEDGGPRPLVDHLRDLLSSWSAVYDALRHTLEDREFEYLAIIEPTTpagngpA 160 Halobacterium sp. GN101
P17565  76 QSLERGLRERWGSLLHTGMVTLTASSTDDEGRLRPPLEHFEDLLESWEAVRRALARVLEGREWEYLAILEPHE------S 149 Halobacterium salinarum
P14321 161 GYAHIHLGVFVKGPVVAEQFQDVLDAHVKNSEGAGREAHRaVVEDDEDEAAVSIRRSARPDREDGIENLGAYLAAYMAGE 240 Halobacterium sp. GN101
P17565 150 GYVHIHLGVFVRGPVVAEQFEPVLDAHLRNCPTAGEDAHQ-VFDENGDEDAVRVRRSSHPSRSGGVENLGAYLAAYMAGE 228 Halobacterium salinarum
P14321 241 YGVEALAMPAHVRAFYAAMWATGTQWFRPSNGAQRHMQPES-DDEESVEEWEMVGIAPEGDLEDeIIEVDPEQPRDDPYR 319 Halobacterium sp. GN101
P17565 229 YGSEPSEMPENVRAFYATMWASGRQWFRPSNGAQELMQPEEdDEGDSIEEWEMVGIAPEGDLGD-IIEVDPSEPRSDPYR 307 Halobacterium salinarum
P14321 320 RLRTPPPGG 328 Halobacterium sp. GN101
P17565 308 RLRTPPPGG 316 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap