3BTP


Conserved Protein Domain Family
VirE2

?
pfam07229: VirE2 
Click on image for an interactive view with Cn3D
VirE2
This family consists of several VirE2 proteins which seem to be specific to Agrobacterium tumefaciens and Rhizobium etli. VirE2 is known to interact, via its C-terminus, with VirD4. Agrobacterium tumefaciens transfers oncogenic DNA and effector proteins to plant cells during the course of infection. Substrate translocation across the bacterial cell envelope is mediated by a type IV secretion (TFS) system composed of the VirB proteins, as well as VirD4, a member of a large family of inner membrane proteins implicated in the coupling of DNA transfer intermediates to the secretion machine. VirE2 is therefore thought to be a protein substrate of a type IV secretion system which is recruited to a member of the coupling protein superfamily.
Statistics
?
PSSM-Id: 399897
View PSSM: pfam07229
Aligned: 2 rows
Threshold Bit Score: 1188.71
Threshold Setting Gi: 197107224
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BTP_A   1 MDPKAEGNGENITETAAGNVETSDFVNLKRQKREGVNSTGMSEIDMTGSQETPEHNMHGSPTHTDDLGPRLDaDMLDSQS 80  unidentified
Q2K2E9   1 MDPKSEDNGENIPVTGERDFENAVVVDPKRQRKEALDSSTTPDIEMTGSHETFEFDIPGTPAHTENVSSQFD-EMLNSQS 79  Rhizobium etli CFN 42
3BTP_A  81 SHVSSSAQGNRSEVENELSNLFAKMALPGHDRRTDEYILVRQTGQDKFAGTTKCNLDHLPTKAEFNASCRLYRDGVGNYY 160 unidentified
Q2K2E9  80 SHDSHSVHGNQSEVDNELSSLFANMVLPGHDRRADEYILVRQTGPDAFAGTSKGDLEHLPTKAEFNASCRLYRDGAGNYY 159 Rhizobium etli CFN 42
3BTP_A 161 PPPLAFERIDLPEQLAAQLHNLEPREQSKQCFQYKLEVWNRAHAEMGITGTDIFYQTDKNIKLDRNYKLRPEDRYIQTeK 240 unidentified
Q2K2E9 160 PPPLAFERIDVPAELSARWHNLEPKDQDKARFQYKLEVWNRAHAEMGVTGTNIFYQTDKNIKLDQNYRLRPQDRYIQT-K 238 Rhizobium etli CFN 42
3BTP_A 241 YGRREIQKRYEHQFQAGSLLPDILIKTPQNDIHFSYRFAGDAYANKRFEEFERAIKTKYGSDTEIKLKSKSGIMHDSKYL 320 unidentified
Q2K2E9 239 YGPREVQKRYEHQFQAGSLLPDILIKTPENHVHLVYRSAGDKFANKSFAEFERIIKTKYGSDTEIKLKSKSGIMHDSRYL 318 Rhizobium etli CFN 42
3BTP_A 321 ESWERGSADIRFAEFAGENRAHNKQFPAATVNMGRQPDGQGGMTRDRHVSVDYLLQNLPNSPWTQALKEGKLWDRVQVLA 400 unidentified
Q2K2E9 319 ESWERGAADIRFAEFAGENRAHNKALPLATINMGGQPDGQGGTTRDRFVSVDFLMQHAPNSPWSQALKKGEQWDRVQVLA 398 Rhizobium etli CFN 42
3BTP_A 401 RDGNRYMSPSRLEYSDPEHFTQLMDQVGLPVSMGRQSHANSVKFEQFDRQAAVIVADGPNLREVPDLSPEKL-QQLSQKD 479 unidentified
Q2K2E9 399 RDGNRYMTPARLEYSDPEHFAQVMNRVGLPHSMGRQSYANSIKFEQFAGQAAVIVANGADLRDIRDLSSEKLqQQLTENN 478 Rhizobium etli CFN 42
3BTP_A 480 VLIADRNEKGQRTGTYTNVVEYERLMMKLPSDAAQLLAEPSDRYSRAFVRPEPALPPISDSRRTYESRPRGPTVNSL 556 unidentified
Q2K2E9 479 VLIADRNEKGQRTGTYTSAAEYKRLLIKLPDDAAQLLREPTDKYSRDFVRPDPVVRPIVDSRRNYENRQRGQSINGL 555 Rhizobium etli CFN 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap