Conserved Protein Domain Family
DUF1422

?
pfam07226: DUF1422 
Protein of unknown function (DUF1422)
This family consists of several hypothetical bacterial proteins of around 120 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399894
View PSSM: pfam07226
Aligned: 18 rows
Threshold Bit Score: 150.899
Threshold Setting Gi: 500023627
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004249699     2 EQNRCEKSTLLLSVVIGVALHGSYSTLFNPLTgPWSIFPLISLVLAVYCLYQRYLNQPMTDGMPKLIFSFFLLGLFGYNA 81  Proteus
Q6LLU1           4 EQVKAERKTLVLSLLAGLCGNATLAVLTSSYV-TFSIFPVIAFGMALYCLYQEYLSKPMTEGTPAIAFSCFLVGVFGYSA 82  Photobacteriu...
WP_011704345     7 DQNPIPKKPLLLALLIGICGDASLTVLSESVV-PFSFFPMIALVLAAYQLYQHYRHVSLEGNTPVCMLLCFFIGVFGHSA 85  Aeromonas hyd...
IBRC:GU3_01440   3 GNKNIRRKPILLALLVGLCGNATLATLSVSEL-AFSIFPIISLVLAAHMLYQEYLSVPMEGDTPVCALLSFLIGVFGYSA 81  Oceanimonas s...
Q5E214           4 ENSRNERKTLVLSVVAGLCLNAVWVGLTVTEV-AFSIFPIIALVLAAQGLYQEYLRPPVSEDTPLIAVACFFVGLFGHSA 82  Aliivibrio fi...
Q9KVJ1           8 QSTRAERKTLILALVAGMCSDALLSWLTMSSV-PFSLFALIALVLSAQMLYQEYLAHPVAEEVPLVGLACFFVGAFGHSA 86  Vibrio cholerae
WP_004236587     3 EQHRRDKGTLLLAFIVGLSVHGTFSALFNSAV-HFSVFPVLALCLAVYCFHQRYLNQMLPEGMPKLVTGTFFLGLFSYNA 81  Morganella
Q7MYE2           2 EQYRQDKSTLLLAFIVGLATNGTFSAVFSSVV-SFSVFPLITLILSVYCIHQRYLNYSMPDGMPKLVVACFLLGLFSYSA 80  Photorhabdus ...
WP_012990508     2 EQYRQDKSTMLLALIVGLATHGTFSAFFNSLV-PFSIFPIIALVLSLYCLHHRYLNYPMADGLPKLVAGCFFLGIFIYSA 80  Xenorhabdus b...
KFD00565         3 EQPNQDNGTLVLALIAGLSINGTFDALFSSVV-TFSIFPIISLVLAVYCLHVRYHRGEMPKGLPGLAAACFLLGLLLYST 81  Rahnella aqua...
WP_004249699    82 YLKTSNPEMGSNFFSSVCIVIIALWIYRQIKQRK 115 Proteus
Q6LLU1          83 FLRAQLPEMGSNFLPLMISLGLLFWVAYKMGIMK 116 Photobacterium profundum
WP_011704345    86 LVKVQYPELGSNFFSLIMMLLLLAVLSIKLGISV 119 Aeromonas hydrophila
IBRC:GU3_01440  82 FLRTQFPEMGTNYLSVMITLVLVIWLAIKMGVAE 115 Oceanimonas sp. GK1
Q5E214          83 LAKAQYPEAGSNFFSILVALALLLWIGVKMGILK 116 Aliivibrio fischeri ES114
Q9KVJ1          87 FIKAQYPQEGSNFFSIVIVLLLIFWIGRKLGYIG 120 Vibrio cholerae
WP_004236587    82 LMRAEYPEAGSNYFSAVFIVIIALWLYRAMKQRR 115 Morganella
Q7MYE2          81 IIRVEYPEIGSNFLPAVMGTVLVFWIYRKVKIRK 114 Photorhabdus laumondii subsp. laumondii
WP_012990508    81 IIRVEYPEIGSNFLPVVIDAALVFWIYRKIKGRK 114 Xenorhabdus bovienii
KFD00565        82 IMRVEYPELGSNFLPSLICVALIFWIGLKLKKRK 115 Rahnella aquatilis CIP 78.65 = ATCC 33071
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap