Conserved Protein Domain Family
Het-C

?
pfam07217: Het-C 
Heterokaryon incompatibility protein Het-C
In filamentous fungi, het loci (for heterokaryon incompatibility) are believed to regulate self/nonself-recognition during vegetative growth. As filamentous fungi grow, hyphal fusion occurs within an individual colony to form a network. Hyphal fusion can occur also between different individuals to form a heterokaryon, in which genetically distinct nuclei occupy a common cytoplasm. However, heterokaryotic cells are viable only if the individuals involved have identical alleles at all het loci.
Statistics
?
PSSM-Id: 399889
View PSSM: pfam07217
Aligned: 41 rows
Threshold Bit Score: 764.858
Threshold Setting Gi: 74632090
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4WZT4                12 LIVVAL-LLVLLPAQVHAFGAGNIASISAVEGKNWRHGDIEDMLKTIAF-----IKG----------------------- 62   Asperg...
XP_009223898           8 PLIVGIlLLFAFAPGVAAFGAGNIASISKIEGQNWRHGDIEDALLKLVMas--aAGG----------------------- 62   Gaeuma...
EHA47862               8 FWLIGIvLLVCWASPAYAFGAGNISSKSPIEGINWRHGDIEDALLGIIMaraldKKS----------------------- 64   Pyricu...
KLU85578               7 FLLAGLvLMVCLASPVLAFGAGNISSKSSIEGINWRHGDIEDALLGILMarglnKKG----------------------- 63   Magnap...
XP_007704460           7 IWLPCLiLLVFWARPTAAFGAGNIASMSSIEGQNWRHGDIEDTLLTLLIs---gHTG----------------------- 60   Bipola...
Q0U1X6                10 FWLPCLvLLVFWARPTAAFGAGNIASLSSVEGQNWRHGDIEDTLLTLLIs---sRTG----------------------- 63   Parast...
Q6BZS5                 4 PILASLsGLAGLFTTAHAFGAGNIPSDSSIEGKNFRHGDIEDVLAGIVIs----HRGgk--------------------a 59   Yarrow...
WGS:AACS:CC1G_00479   11 FLIVAT--VCILLPRAHAFGAGDIPDFAYLNDKAFRHGDIESVLENLAK-----TAGraaigggnllafassvvsaatgp 83   Coprin...
XP_007325739           8 FLLVFT-VLLVLTPSTYAFGAGDIPDFAYLNDKAFRHGDIEAILETLVK-----NVGssaagggllsf-atsvlesatgg 80   Agaric...
CCA67339               8 LLVIAF-VLAVLPTSAHAFGAGNLPSYAYLEDKAFRHGDIEDVLAELLK-----RTGsgll----------------kqg 65   Serend...
Q4WZT4                63 HKWTSTMVKRVYFGNWLRDYSQAMDVGTLK-SLPADTIRILVWILSFLSFGYATAEFEVTSERLGVYRPEEHIDNPKDYA 141  Asperg...
XP_009223898          63 NKFGKLDVSRVYFGNWLRDYSQAIDVGTVK-NVSAEAIRLLLCVLGFLTFGYGSREFEVTADRLGCYRPEDHIDNPKNYA 141  Gaeuma...
EHA47862              65 KKFNKMAVMRVYFGNWLRDYSQAVDLGTIK-NVSYEAIRLVVAILAFMNFGFGSKEFEVTPERLGCYRPEEHIDSPKGYG 143  Pyricu...
KLU85578              64 KKFNKLMVSRVYFGNWLRDYSQAVDVGTIK-SVSYEAIRLVVAILAFMNFGLGSKEFEVTPERLGCYRPEEHIDNPKGYG 142  Magnap...
XP_007704460          61 KKFSKMDVKRVYFGNWLRDYSQAVDVGTVK-MVSAEAIRILLWVLGFMSFGYGTKEFEVTRDRLGCYRPEEHIDNPKDYA 139  Bipola...
Q0U1X6                64 KKFSKMDVKRVYFGNWLRDYSQAVDVGTVK-MVSAEAIRILLWVLGFMSFGYGTKEFEVTRDRLGCYRPEEHIDNPKDYA 142  Parast...
Q6BZS5                60 RKFDGLDIKRVYFGNWLRDFSQAVDVGTLSmGLNADTVRAIIWLVSMSEFGYGTGEFEVTEERLGVYRAEEHMDNPKGYP 139  Yarrow...
WGS:AACS:CC1G_00479   84 RKFNKNDIKKVYFGNWLRDYSQCMDIAGLS-KLSAETLVLVVSVLGFMTFGFSTEEFEVTAERLGVYLPVEHIDNPKGYA 162  Coprin...
XP_007325739          81 AKFNKMDIKRVYFGNWLRDYSQAMDIAGLS-KLTADTITLIVSILGFMTFGYATEEFEVTQERLGVYLPVEHIDNPRGYA 159  Agaric...
CCA67339              66 SKFKGLDIKRVYFGNWLRDYSQAVDVAGLK-ATTIQNIITICTVLGFMAHGFVTDEFEVTEERLGVYLPVEHIDNPKGYP 144  Serend...
Q4WZT4               142 DNQ-DARQYDSRLRGPIRQ-VELEIDPQTGMKNYIANERGDWATSTAYIKYSLARSIHYGRLYTSGGH-HKGKEEDLCEA 218  Asperg...
XP_009223898         142 DNQ-DATRYDRRLRGPVDEsVELAVDEETGLKNYIANERAGIMTSAQHVRNLFGRCIELGRSYg-----RNRNKAELYEA 215  Gaeuma...
EHA47862             144 GGD-NPKRYWEGLRGPVDEeRELTVDPDSGMKNYIANERAGIDTSAGLLRNLLGRCIDLGRAHa-----RSGRDEDLYES 217  Pyricu...
KLU85578             143 GGE-DAQEYWHGLRGPVDEeLELAIDEETGMKNYIGNERVGIANSASLLRHLLGECIERGRRHg-----RDGNEEDLYEC 216  Magnap...
XP_007704460         140 DNI-DARDYDRRLRAPVDErRELSIDEKTGLKNYIASEELGITTSAGMVRDLLARCIDLGQR-------SGGRGPDFYEA 211  Bipola...
Q0U1X6               143 DNL-DAREYDRRLRAPVDErRELSVDERTGLKNYIASEDLGITTSAGMVRDLLRRCIDLGRR-------SGGRGPDFHEA 214  Parast...
Q6BZS5               140 E---DAQQYDRRLRGPVDP-RELEIDPKTGMKNYIANEDGDWATSSEYVREQLLRCIKLGRRYIKGGYkKHSLQ---HES 212  Yarrow...
WGS:AACS:CC1G_00479  163 EKEgDAREYHPKLRPPVDP-RELEIDPETGMKNYMATEGQGWDTSTGFIRRTLRECIEYGRRa------NGEENADLWEA 235  Coprin...
XP_007325739         160 EKEgDARQINSNLRPPVDP-RELEIDERTGMKNYMASDNQGWDTSTAFIRRTLKACIEHGRRa------GGQENGDLFEA 232  Agaric...
CCA67339             145 D---DARKYHPKLRGPVDP-RELEIDLRTGMKNYIANEDGGWDTSRALVRRRLQECINIGRRYr-----STHNKADQYEA 215  Serend...
Q4WZT4               219 LRCLGQGLHTLEDFAAHTNYCELALREMGFRNVFPHTGAATEMNI-RGHR--VFPLVTGTFGMVDFFHSVLGEATDHFTQ 295  Asperg...
XP_009223898         216 LRLLGTGLHCLEDYFAHSNYAELALIEMGERDVFPHVGRNTQLRI-PGARhsVYPAVTGTFGGVDFLHSVTGEVSDKLTQ 294  Gaeuma...
EHA47862             218 MRLMGTAMHCLEDFFAHSNYVELALIEMGHRDVFPHVGRDTKLRI-PGSRgeVYPIVTGTFGEVDFLHSVAGEVSDKIKQ 296  Pyricu...
KLU85578             217 LRLMGTALHCLEDFFAHSNYVELALIEMGEREVFPHVGRDTRLRL-PGARrrVYPVVTGTFGEVDFLHSVAGEVSDKLMQ 295  Magnap...
XP_007704460         212 LRLLGTATHCLEDYAAHSNYVELALIELGEHAVFPHVGKNARFYV-AEAKkeVYPIVTGTFGGVDFLHSVCGEITDKTTQ 290  Bipola...
Q0U1X6               215 LRLLGTATHCLEDYSAHSNYTELVLIELGERDIFPHVGRNAQFEI-QAARkqVYPIITGTFGGVDFLHSVCGELSDKATQ 293  Parast...
Q6BZS5               213 LRLLGSALHTLEDFTAHTNYLELVLRDMGYKDVYAHVGNQTRIKL-AGKK--VFPVVTGTFGGLDFLHSLLGGAHDSLSE 289  Yarrow...
WGS:AACS:CC1G_00479  236 YRLLGTGLHTLEDLMAHSNWCELALRKMGYEEVFCHVGDNVLVDTpNGP---APPLVTGTFGGADFLHSLLGEAGDKLSQ 312  Coprin...
XP_007325739         233 YRLLGTGLHTLEDLLAHSNWCEIALRKMGHEEVFCHVGDNVIVETpNGP---CPPLVTGTFGGADFLHSVLGEAGDHLSQ 309  Agaric...
CCA67339             216 FRLLGSALHTMEDFPAHSNFCELALVSMGCNQVFTHVGDNVRIPApNGKF--VAPLVTGTFGGDDFQHSLLGEAGDHISQ 293  Serend...
Q4WZT4               296 SEVNEMDIALGDAQANS---SGGSLSAFTGLLGKIP---------------GTKD-LIAEAEELKRRSDAQQYANQHggq 356  Asperg...
XP_009223898         295 NEIQELEATLDNNKRND-------NSGLKDLLDKLPpgl-------------igGdKKDRLDEIQENNAAAQMEQM---- 350  Gaeuma...
EHA47862             297 NELQELEELLQDNKKND-------TSLLKNLFKMLPdsl------------fgGEsQSSKMDQIEQDCTQAQMNNL---- 353  Pyricu...
KLU85578             296 NEMQELQAHLEDNQNQK-----SDTSLLRTLLDMIPdgl------------fgGEhQSDKMSEIQQNCTNAQMEGL---- 354  Magnap...
XP_007704460         291 SELQELEGAISNADRSK------NKSKIKELLEKLPegi------------fgGKdESSKADELENNANAAVMGNM---- 348  Bipola...
Q0U1X6               294 SELQELEGAISDADRKK------NKSQIKDLLSQLPdgi------------fgGKdQGGKADELENNASAAAMGNM---- 351  Parast...
Q6BZS5               290 SGFTEASANFEKKKKSG----SNTSEFLKSILRKLPiklpdipdahggfrdMTGAdLADHLDELQHNVEEYVVHQREhdg 365  Yarrow...
WGS:AACS:CC1G_00479  313 ASVTDLSGKLNEAQQSG----GADLGPLKNILSRIMgg------------sSEEEeKLNQGEEMKEAAQGY--------- 367  Coprin...
XP_007325739         310 ASVTELTSKMNEASQGE----ESNISAFKDIIGKLPm--------------GGNDdKVNQGDQMQQQSKAY--------- 362  Agaric...
CCA67339             294 SSISDLNEHVNKARAKSasgDFGSANKIKALIATIP---------------------SPEAQSMSRDIDTMQANRAt--- 349  Serend...
Q4WZT4               357 rtgyahetsrgldsygsavgrdlgeslsrasgpsqpstSGGPAGPGLPGM-P----------------------DFDPKK 413  Asperg...
XP_009223898         351 ------------------------------------------------NVsP-----------------------REPEE 359  Gaeuma...
EHA47862             354 ------------------------------------------------EVrP----------------------HREPEE 363  Pyricu...
KLU85578             355 ------------------------------------------------DVrP----------------------HREPEE 364  Magnap...
XP_007704460         349 ------------------------------------------------RItP-----------------------KDPEE 357  Bipola...
Q0U1X6               352 ------------------------------------------------HVtP-----------------------KEPEA 360  Parast...
Q6BZS5               366 ndedckd----------------------cgdtkkksrTGGSGGNAQQGQhPlvlvdqppfkntpggtniskvhNNDPNY 423  Yarrow...
WGS:AACS:CC1G_00479  368 --------------------------------------------------------------------------HFDPDN 373  Coprin...
XP_007325739         363 --------------------------------------------------------------------------NFDPND 368  Agaric...
CCA67339             350 ---------------------------------------------------P----------------------GKDPNT 356  Serend...
Q4WZT4               414 --------------TVAQIYPILQFRDNVVRKLSSII---EKIPGLEALVEKVTETLTIFVMSLLAPFIRPIINAASNSL 476  Asperg...
XP_009223898         360 ftrq-------vqqVFGQIMPVIEFHDEIFQNISQAL---ENIPILPQILEQFQEQMSMWVFTQIAPFVLPIIRQIKNEL 429  Gaeuma...
EHA47862             364 itkw-------vsnIFKQIIPVIEWHDRIMKIISDAL---PSIPVIPKIIEQLEDQLNAFVMMQLAPFIVPVLQQIQNEM 433  Pyricu...
KLU85578             365 mtiw-------vgnIFRQVVPIIEWHDRIMKAISDAL---PTIPVIPKIIEQLEDQLNAFVHAQIAPFVVPVLKQIQNEM 434  Magnap...
XP_007704460         358 ftqq-------igeLVKQIYPIMEFHDEIMQSISEFI---EKIPILPDLIEEVQNQVTIFVFSLLAPYVLPILSQVKTEL 427  Bipola...
Q0U1X6               361 fteq-------lgeLVKQIYPIMEFHDEIMMSISEFI---EKIPILPEIIEQVQEQVTVFVFSLLAPYVLPIISQVKAEL 430  Parast...
Q6BZS5               424 tslesyldnldvdaVIRAVYPLLEFKDSVMSSLESFFgdsDSSTALGMMASSISDALSSFTNSIINPIINPILEAVTEIL 503  Yarrow...
WGS:AACS:CC1G_00479  374 iap---------peVQQKLLDLLKWHDDVMRNVTKKM---AMVPGLNNLLEEFSNALNGYIYTVLAPYLTPILAQATSVL 441  Coprin...
XP_007325739         369 iap---------peVQRNLIDVLKWRDSIVKDITQKM---DMVPGLSDLIDELTNALNAYVYTILAPYVVPLITSATGIL 436  Agaric...
CCA67339             357 mtp---------keLYQNIWAILSFRDSVVKKMSYGI---EKIPGLGPLIDSIMENLTVFVIQTLEPYLKPLMKTATTQL 424  Serend...
Q4WZT4               477 QAGSSSVIDASGKHQFEPWTNPHCTDPTHSMLSKDHFSNILNEPAGRVASAILKYVAPRVLYAWEHPEVPEQQVLDDCLC 556  Asperg...
XP_009223898         430 KTGSSEIIESSKNEQHIVFEDDNSTDPTHSMLSKDHFTNILNEVAGKTAKKVVEWVVPQIMQAWDDHNMDVGRLMNRIIS 509  Gaeuma...
EHA47862             434 NAGSNGIVESSKRDQFVVFDDDRSADPTHSMLSKDHFTNLLNEPAGKTAAEMVKWVVPQIMQAMDDESIDIGRTVNRIIY 513  Pyricu...
KLU85578             435 GAGSEGIIESSKHNQHNVFENDEETNPTHSMLSKDHFTNLLNEPAGKTAAEMVKWAVPHLMEAIDNEDVDITRTLDCIIS 514  Magnap...
XP_007704460         428 EEGSTEVIASSRDKQHIVFNDDDCTDPTHSMLSKDHFSNVLNEPAGRVASATIAWAVPQIVQCWDGQA-DPTQTIDTIIE 506  Bipola...
Q0U1X6               431 ETGSSEVIASSREKQHIVFNDDYSTDPTHSMLSKDHFSNILNEPAGRVASAVLTWAVPQIVQCWDGQG-DPEETISRIID 509  Parast...
Q6BZS5               504 H--ASVTLLSYHDDQIDVWINSKSTDPTHSRLSKDHFAAYLNEPAGLVAAEVVKYVVPFVVEAWEDPSIDPQTVVDEALQ 581  Yarrow...
WGS:AACS:CC1G_00479  442 DEGSKAVIDSE--DQYEVFDNPDAHDPSHSLLSKDHFGLILNEPAGKIAQIIVEHTVNHIVQAWYNDE-DPDSVLNVILE 518  Coprin...
XP_007325739         437 DEGSKEVINNS--DQYQVFDDPDASDPSHSILSKDHFALILNEPAGKIAQVIDEYAVNLIVRAWSDDS-DPDSVLDAILE 513  Agaric...
CCA67339             425 AASSAAVINKL--DQYEVFHDPNASDPTHSILSKDHFNLILNEPAGNLAKIIVIHTVKLVVHAWDHAEDNIHHVTETILE 502  Serend...
Q4WZT4               557 -VFHHPAL-RDMHN-----EAHRTMFEAVQNWAHSRPDRGAs-LNDILSSEGVRAGKNNGGE 610  Aspergillus fumigatus
XP_009223898         510 gVLHHPAQ-RDQGRdg-aeEGRSIIFRSVEEWWNGMDEGAKdeYRRKLSREGVENGQNHKEG 569  Gaeumannomyces tritici R...
EHA47862             514 gVLHHPAQ-RSLGHdg-anEGREIFFRSIEQWWGCMGPDQQrdYLRRLSRDGVRNHENHKEG 573  Pyricularia oryzae 70-15
KLU85578             515 gVFHHPCQ-RDMGGag-aaEARTIFFSCVEAWWNEMDPEKQddYRRRLSRDGVRNHENHKEG 574  Magnaporthiopsis poae AT...
XP_007704460         507 gVFHHPAC-VDMEPktkmmEGRAIMFNTVSKWWDSKDDDAKveFRKQLSREGVRNGKNHKEN 567  Bipolaris sorokiniana ND...
Q0U1X6               510 gVFHHPAV-PQGRVrg-seQCRSIMFQTVEKWWRAQPD--QddLRRKLSRRGVQNGENHKPG 567  Parastagonospora nodorum...
Q6BZS5               582 -TFHHPALaHT--------KLHRIMRAEVDRWIQTFSDEERehILEGLTSRGVLHGHNNAEH 634  Yarrowia lipolytica
WGS:AACS:CC1G_00479  519 -AFHHPYY-NTGNS-----EVQHKMFEHMQKWIGGLGPDEAaqTIEALTKESVREHKNKRLG 573  Coprinopsis cinerea okay...
XP_007325739         514 -AFHHPYY-ATGSS-----QIQNKMFEHMEMWFGGLGSEVAsqVIQRLTKESVREHNNKRIG 568  Agaricus bisporus var. b...
CCA67339             503 -CMFHPDF-HNPRS-----SVQKEMMEFMRQWLSTHSAGHHd-VLSRLTKEAIRNHQNVRKQ 556  Serendipita indica DSM 1...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap