Conserved Protein Domain Family
DUF1419

?
pfam07215: DUF1419 
Protein of unknown function (DUF1419)
This family consists of several bacterial proteins of around 110 residues in length. Members of this family seem to be specific to Agrobacterium species and to Rhizobium loti. The function of this family is unknown.
Statistics
?
PSSM-Id: 399888
View PSSM: pfam07215
Aligned: 14 rows
Threshold Bit Score: 188.362
Threshold Setting Gi: 123057214
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q11MT7                      1 MNPSsPIRKVYQGIADRRQMFRMFDRHTQRPNRFEDADAGLYRGEWFELTEIEHDYMFNILPPLFMNGEMFAMREFLTGC 80  Ch...
WP_011993003                1 MNLP-PVRKVFEGVADRRQMFRMFDRHAQRPNRWQGDDSVLYRGEWFEIGQVEHDYMFEVLPPLWMRGDMFAMREFLTGN 79  Xa...
WP_011993075                1 MTLStPIRKVFQGVPDRRQMFRMFDRHAQRPFRWDGDASALYTGEWFETSPVDHDYMFEILPPLWMRGDMFAMREFLTGS 80  Xa...
WP_011982941                1 MNTSpAIRKVYQGVADRHQMFRMFDRHAQRPDRWNDDATALYSGEWFEIRESEHDYMFEILPPLWIRGSLFAMREFLTGS 80  rh...
vbi:Avi_9538               43 TSSEp--RKIFQGVATRSQMFSLFDRHRQMSSRFDGDVSALYAGEWFAIGEAEHDYMFDILPPLWIRGDTFAMREFMTGS 120 Ag...
goetting:OCA5_pOC16701390   1 MTLL-SVRKVFQGIADRRQMFRMFDRHAQRPEP-SPDDAHLYRGEWFEVGQPEHDYMFEILPPLWMRGDAFAMREYLTGS 78  Ol...
Q6LB72                      1 MTLS-PIRKIFQGVADRRQMFRLFDRHEQRPNAHPADDQHLYVGEWFEISPENYQYMFDILPPLWMEWDMFALSRPLTGA 79  Ol...
Q1QFE1                      2 HT-SpTIRKIFEGVATRPDMYRMFNRHRGDPAVAEGDAQHLFAGEWFEIAEREHDYMLEILPPLWMRTDMFAMREFMTGN 80  Ni...
BAI96679                    1 mveHpTYTKVIEGVATRKQMYALFNRVPDGAPPENLHSGAAFAGQWFEIREAEYEYMFELLPPRFIRSGMFGMSELKAGT 80  Sp...
Q11N75                      1 MSDHpPFRKVFDGVASREQMFQLFNRHRDTPGI-DVLSGKPYAGEWFEITADGYRFMLELLPPLFQRTGMFGISEFKAGY 79  Ch...
Q11MT7                     81 ITSVFFTLKIDDRMRFFHAYCDLADKGSPAHM 112 Chelativorans sp. BNC1
WP_011993003               80 ITSVFVSLTIDGRSRYFHGYCDVSDRTSPAQM 111 Xanthobacter autotrophicus
WP_011993075               81 VTGVFFALMIDGRVRHFHGYCDLADTASPERM 112 Xanthobacter autotrophicus
WP_011982941               81 ITSVFFALRIDGTIRHFHGYCDLSDTSSVENM 112 rhizobacteria
vbi:Avi_9538              121 VTSVFFTLQIDGAIRHFHSYCDLADTQSVGRM 152 Agrobacterium vitis S4
goetting:OCA5_pOC16701390  79 ITSVLFALTIDNNLRFFHAYCDLSDRSSSERM 110 Oligotropha carboxidovorans OM5
Q6LB72                     80 LTSIFFNLKVSDRPRYFHGYCDLSDRGSPERM 111 Oligotropha carboxidovorans
Q1QFE1                     81 VTSVFFALWIDGRKRFFHGYCDLSDRRSPECM 112 Nitrobacter hamburgensis X14
BAI96679                   81 VGSIFCEIMIEGRKRWFHGYCDFADRGSPEAM 112 Sphingobium japonicum UT26S
Q11N75                     80 VTSVFFAIRIRGRERWFHGFCDLSDKRSPDTM 111 Chelativorans sp. BNC1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap