2DP5


Conserved Protein Domain Family
Hyaluronidase_1

?
pfam07212: Hyaluronidase_1 
Click on image for an interactive view with Cn3D
Hyaluronidase protein (HylP)
This family consists of several phage associated hyaluronidase proteins (EC:3.2.1.35) which seem to be specific to Streptococcus pyogenes and Streptococcus pyogenes bacteriophages. The substrate of hyaluronidase is hyaluronic acid, a sugar polymer composed of alternating N-acetylglucosamine and glucuronic acid residues. Hyaluronic acid is found in the ground substance of human connective tissue and the vitreous of the eye and also is the sole component of the capsule of group A streptococci. The capsule has been shown to be an important virulence factor of this organism by virtue of its ability to resist phagocytosis. Production by S. pyogenes of both a hyaluronic acid capsule and hyaluronidase enzymatic activity capable of destroying the capsule is an interesting, yet-unexplained, phenomenon.
Statistics
?
PSSM-Id: 399887
View PSSM: pfam07212
Aligned: 2 rows
Threshold Bit Score: 514.645
Threshold Setting Gi: 109157496
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DP5_A  59 NKPNIDGLATKVETAQKLQQ----KADKETVYTKAESKQELDKKLNLKGGVMTGQLKFKPAATVAYSSSTGGAVNIDLSS 134 Streptococcus pyogenes
Q99ZZ7  93 NKPDLGAFAQKEETNSKITKlessKADKNAVYLKAESNAKLDEKLNLKGGVMTGQLQFKPNSGIKPSSSVGGAINIDMSK 172 Streptococcus pyogene...
2DP5_A 135 TRGAGVVVYSDNDTSDGPLMSLRTGKETFNQSALFVDYKGTTNAVNIAMRHATTPNFSSALNITSGNENGSAMQLRGSEK 214 Streptococcus pyogenes
Q99ZZ7 173 SEGAAMVMYTNKDTTDGPLMILRSNKDTFDQSVQFVDYKGTTNAVNIVMRQPTTPNFSSALNITSANEGGSAMQIRGVEK 252 Streptococcus pyogene...
2DP5_A 215 ALGTLKITHENPSIGADYDKNAAALPLDLSKRQNGA-GTAAQGIYINSTSGTTGKLLRIRNLSDDKFYVKSDGGFYAKET 293 Streptococcus pyogenes
Q99ZZ7 253 ALGTLKITHENPSVDKEYDKNAAALSIDIVKKQKGGkGTAAQGIYINSTSGTTGKLLRIRNLNDDKFYVKPDGGFYAKET 332 Streptococcus pyogene...
2DP5_A 294 SQIDGNLKLKDPTANDHAATKAYVDKAISELKKLILKK 331 Streptococcus pyogenes
Q99ZZ7 333 SQIDGNLKLKDPIANDHAATKAYVDGEVEKLKALLAAK 370 Streptococcus pyogenes serotype M1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap