Conserved Protein Domain Family
Orthoreo_P10

?
pfam07204: Orthoreo_P10 
Orthoreovirus membrane fusion protein p10
This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction.
Statistics
?
PSSM-Id: 115833
View PSSM: pfam07204
Aligned: 3 rows
Threshold Bit Score: 143.144
Threshold Setting Gi: 75568258
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q84142  1 MFSMSSGSCNGATSIFGNVHCQAAQNTAGGDLQATSSLIAYWPYLAHGGGLIIIIIIvICLVCCCRAKVKRDATRSVFYR 80  Orthoreovirus
O12285  1 MLRMPPGSCNGATAVFGNVHCQAAQNTAGGDLQATSSIIAYWPYLAAGGGFLLIVII-FALLYCCKAKVKADAARSVFHR 79  Avian orthoreovirus
Q9J1B2  1 M----SSDCAKIVSVFGSVHCQSSKNSAGGDLQATSVFTTYWPHFAIGGGIIVVILL-LGLFYCCYLKWKTSQVKHTYRR 75  Nelson Bay orthoreovirus
Q84142 81 ELLTLNSGKCNAAPPSYD-V 99  Orthoreovirus
O12285 80 ELVALSSGKHNAMAPPYD-V 98  Avian orthoreovirus
Q9J1B2 76 ELIALTRSHVHSTPSGISyV 95  Nelson Bay orthoreovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap