4LD1,4BXQ,4BY2


Conserved Protein Domain Family
Tcp10_C

?
pfam07202: Tcp10_C 
T-complex protein 10 C-terminus
This family represents the C-terminus (approximately 180 residues) of eukaryotic T-complex protein 10. The T-complex is involved in spermatogenesis in mice.
Statistics
?
PSSM-Id: 399882
View PSSM: pfam07202
Aligned: 168 rows
Threshold Bit Score: 32.0543
Threshold Setting Gi: 91084597
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LD1_A        106 PDGREESVLTDGTIIQLNPD-GSKVIQFNTGQREIH 140 
ORX80007     1404 PDGSIEIIFPDKTVRRIFAN-GEEENVYANGIKMRT 1438 Anaeromyces robustus
ORX81040       69 TKEYRQRIQPDGVTKTIYSN-GIQVTQYPNGRVRIK 103  Anaeromyces robustus
XP_026680185 1233 TREYKRREFPDGAVKLVYPD-GIQETRYPNGRIRLK 1267 Asian citrus psyllid
XP_013074884 1515 TAEFQRREFPDGIIKTVYAD-GRHETRFPNGRVRLR 1549 Biomphalaria glabrata
XP_029844672  967 HESYRSRSYPNGTVKTIYPS-GKQITKYSNGKVRVK 1001 black-legged tick
XP_021918845 1224 YKGEMRREYPDGTVKTVYAD-GKLETRYANGRIRVR 1258 Zootermopsis nevadensis
PAA90281      829 PDGSREIQFPDGVVKSVSADaTEEVSAFPDGTRLRL 864  Macrostomum lignano
XP_019858560   45 RNGSKDIIFPDGTIRHVLPS-GEEKIKFSDGVTQRV 79   Amphimedon queenslandica
SPR00190      402 PDGSKQITFPDGVVKVVQAN-GDEEVRFCNGLVHRV 436  Plasmodiophora brassicae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap