Conserved Protein Domain Family
DUF1409

?
pfam07197: DUF1409 
Protein of unknown function (DUF1409)
This family represents a short conserved region (approximately 50 residues long), sometimes repeated, within a number of hypothetical Oryza sativa proteins of unknown function.
Statistics
?
PSSM-Id: 369256
View PSSM: pfam07197
Aligned: 6 rows
Threshold Bit Score: 75.1744
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAG99551           106 RLG-SSLDSLVTGCGSIRARFEEIHHQIPEDEADIISLAVYLEQHRFKL 153 Japanese rice
3_pfamImport         1 RLN-IKIESLVFDSGSIRSRVLEIVNQLPDDLADSLNSVAYLEQYNTRV 48 
WGS:AAAA:OsI_32978 113 WLN-ASVDALVKNVGPIRSRVDDIQYQLPDELFNVLTPAAYLESHW--L 158 long-grained rice
2_pfamImport         1 RLD-YPIDTLINDVGPIRCRIEEIQDQLPNDLVDSIAPTGYIESHQIPV 48 
XP_015696626       132 RLD-YPINTLINDVGSIRSRIEEIQDQLPDDLIDAIAPVGYIESHRLPV 179 malo sina
ABA97890           206 RLEaSSLDSLVVDCGSIRSRLHEVQALIPEDLADVLTPAAYLEQHQFKL 254 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap