Conserved Protein Domain Family
SNURF

?
pfam07192: SNURF 
SNURF/RPN4 protein
This family consists of several mammalian SNRPN upstream reading frame (SNURF) proteins. SNURF or RPF4 is a RING-finger protein and a coregulator of androgen receptor-dependent transcription. It has been suggested that SNURF is involved in the regulation of processes required for late steps of spermatid maturation.
Statistics
?
PSSM-Id: 369255
View PSSM: pfam07192
Aligned: 2 rows
Threshold Bit Score: 98.9966
Threshold Setting Gi: 81869801
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9WU11         4 GRDRLHLRRTTEqHVPEIEVQVKRRRTASLSNQECHLYPRRSQQQQIPVVDFQAELRQAFLAETP 68  Norway rat
XP_025790396  17 ARDGLHLRRTXR-HVPEVQVQVKCRRRASLSNQECQLYPRRSRQQQVPVVDFQAELGRRFFAGTP 80  puma
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap