5HY7


Conserved Protein Domain Family
SF3b10

?
pfam07189: SF3b10 
Click on image for an interactive view with Cn3D
Splicing factor 3B subunit 10 (SF3b10)
This family consists of several eukaryotic splicing factor 3B subunit 10 (SF3b10) proteins. SF3b10 is a 10 kDa subunit of the splicing factor SF3b. SF3b associates with the splicing factor SF3a and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex. SF3b10 and SF3b14b are also thought to facilitate the interaction of U2 with the branch site.
Statistics
?
PSSM-Id: 399875
View PSSM: pfam07189
Aligned: 68 rows
Threshold Bit Score: 79.8912
Threshold Setting Gi: 149246820
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HY7_D         4 KLRNQQELERLQAKYVGTGHPDTTSWEWKTNIHRDTYSSIVGHPPLLSYMALAQ-NEPVAKFRVQMIRKMLQPVG 77  Chaetomium thermophi...
EPY53625       4 RLRSQAKLEQLQARFVGVGHSSTTKYEWMVNQHRDALSSIVGHPPLLAYMSTAL-GESRTQVRQQMLEKMIMPCG 77  Schizosaccharomyces ...
Q6CGS7        40 KLREQQLFQLSQSRYLGVGNPDTTKQEWQTNVARDSYASYIGHPGVLSHMSLAL-GQTEAETRIQFLDKLAKVGT 113 Yarrowia lipolytica
CAR65222       4 KVKEELIYEDMRKKHPGVGSARTTKEEWSNTISKDTYASLAIHQNLLEYYTLASgFPSKRDAQLTLLRKLANPpk 78  Kluyveromyces lactis
ESX00201       4 KIREKQLYEALKSKHIGLGNEETTRTEYISNIKRDTYASLVAHPAMLEFLSNTY-NKPRQIVHTEMIEKMIRPME 77  Ogataea parapolymorp...
EDK37762       4 KVKDARLYSANKARYIGLGDPDTPREEFVTNIHRDTYASLGQHDSLLTYTAVAM-NRSPEVVRQQMIKKMVQPKG 77  Meyerozyma guillierm...
Q6BLV4         4 KVKDINQYNQLKSKYIGLGNADITREEFMTNVNRDIYSSLAQHDNILYYNSVII-NEPMELLRQKMIKKMASPIQ 77  Debaryomyces hansenii
XP_002618235   4 KVRETHQYLHLKGKYIGLGNADTTRDEFLSNIHRDTLASLAMHDNMLTYQATAT-NTHPELVRQALIKRMVQPLS 77  Clavispora lusitania...
CCE41909       4 KIREKNQYALLKQKYPGIGNADTTRDEFLTTTYNDTIASLAHHKHINYYNSIVT-NKHPNLMKQEMIKKIKSDAt 77  Candida parapsilosis
XP_001527835   4 KIREKHQYALLKSKYDGIGNSDTTSKEFQTTIYNDTFASLAHHKHLLLHNAVIR-NEHPELVRQEYLKKL-KPMp 76  Lodderomyces elongis...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap