4KT5


Conserved Protein Domain Family
CaiF_GrlA

?
pfam07180: CaiF_GrlA 
Click on image for an interactive view with Cn3D
CaiF/GrlA transcriptional regulator
This is a family of transcriptional regulators. CaiF is involved in carnitine metabolism. GrlA is encoded within the LEE type III secretion system in the enteropathogenic E. coli O157:H. GrlR interacts with GrlA at its Helix-Turn-Helix (HTH) motif, preventing GrlA from binding to its target promoter DNA.
Statistics
?
PSSM-Id: 369250
View PSSM: pfam07180
Aligned: 3 rows
Threshold Bit Score: 216.027
Threshold Setting Gi: 446258399
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KT5_C         3 SKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIITYISRRKEKISFRVRYVSYGNlH 82 
Q8VLD0        18 SKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIITYISRRKEKISFRVRYVSYGNlH 97  Escherichia coli
WP_000336254  23 GQTNHDACFIPVSVRQYAGEPLYIIVAHWCLLQQNWVQRNQIAEAFHITARRASYLIAYLRSKTSRVVSICRHQTLPN-K 101 Salmonella ente...
4KT5_C        83 YKRLEIFIYDVNLEAVPIESPGTTGP----KRktyRVGNGIVGQSN-IWNEx--------IXRRKKE 136
Q8VLD0        98 YKRLEIFIYDVNLEAVPIESPVSTGP----KRknyRVGNGIVGQSN-IWNEm--------IMRRKKE 151 Escherichia coli
WP_000336254 102 ARRYEIYVIRVLDSPTPSTRREKAGPppvsKR---RVGNGDRSMANeLWNRlcsnrnagkILKKKED 165 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap