Conserved Protein Domain Family
DUF1400

?
pfam07176: DUF1400 
Alpha/beta hydrolase of unknown function (DUF1400)
This family contains a number of hypothetical proteins of unknown function that seem to be specific to cyanobacteria. Members of this family have an alpha/beta hydrolase fold.
Statistics
?
PSSM-Id: 399868
View PSSM: pfam07176
Aligned: 180 rows
Threshold Bit Score: 69.0256
Threshold Setting Gi: 123769287
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q113H2          41 AAKHISVGHEGLNTLISVSALESYVQNGEINYELASYMLlLEAEDEQEYRDFLQTRYNFPPQIVAQFLHSPMGKLFLNSL 120 Trichodesmium...
Q110K9          39 A--------GPIKASIKVKDLRLFAETGETTKTISQALA-ISKVNPNTVRGLMTLEVGAGVTNLAKVLYSNLGQNVTKGV 109 Trichodesmium...
WP_015177290    44 GAEKVVLTFGPIRQAIKIGDLEDFAKNGTTTPTLQQIIR-FSKMDAQILRGFMGLEIGLKPANLARVVYSTPGEKITDDI 122 Oscillatoria ...
WP_006618721    30 AAERVILTYGPFQAPINISDLEAFTRDGVTTKTIRQIVG-ASGIQADTLRGLMGLEIGFDLVPFSCMIYTPTGQELTDEI 108 Arthrospira p...
Q7V3R8          32 AAKEVALVSGAFRRSISVSDLEYLAKTGKARGLLKDALK-FGRQNPETVSKLLNKKLELPIGLTSRLMTTRIGNVIINRI 110 Prochlorococc...
WP_011934417    31 AAEDVALVSGAFIRSISVADLAYLAETGEARGLLSDLLR-LGKQDPENVAKLLNQELDLPLVLTSRLMSTKIGDVILKRV 109 Synechococcus...
jgi:Cyagr_0959  32 AAEQVVFVSGAFRRSIPVADLERLARTGEAVGLLGDALR-LGGKDPAEVGKLLNHRVTLPLVQTTRLLSTRFGENALERL 110 Cyanobium gra...
jgi:Cyagr_2393  25 ATENLVFTSGAFRRSIPVADLEHLATTGEARGLLADVLR-LGRQDPKQVSKLLNESVRLPIVLMSRLLNTRIGEAILARL 103 Cyanobium gra...
WP_011936946    16 ATENVVFVTGAYRRTLTVSSLDKFVETGVPKGLLADLLR-FTGSQPKPIQGLLKTEIPLPVTLTSRLLNTRIGEAILERA 94  Synechococcus...
Q7V9E9          27 SAEKITFYISILSRSITVEELENFSKRGVKSQFLKRVLK---NQNEREIREILRKEYKAPIKLTSRLLYSKIGGVILKRV 103 Prochlorococc...
Q113H2         121 GEVIKTHsvnsgSSSieNGAEAIKTALLKSAND-SAGLSIINFVRHFPS-----D 169 Trichodesmium erythraeum IMS101
Q110K9         110 AEVLQTK-----HNY--ESDKALRSAIILAAAD-DNRISVLEILEKYPTeemhiD 156 Trichodesmium erythraeum IMS101
WP_015177290   123 GQAIRTQ-----RRT--ESGKALRAAVILASGD-DGKVSLLEILKKYPLnevyvD 169 Oscillatoria nigro-viridis
WP_006618721   109 GATVRTH-----RRV--ANGKAIRAGLINALSN-DGKISFLEFLKYYPVpgmyvd 155 Arthrospira platensis
Q7V3R8         111 SKIIYPLn----VPNpsVSVPAFRAGVINGMQIgKGGLNAIHFLKAYPNetmtiN 161 Prochlorococcus marinus str. MIT 9313
WP_011934417   110 AKIVYPLr----VPEpsVSVPAIRAGVINGLQIgEGGLNMIKFLEAYPAevmeiN 160 Synechococcus sp. WH 7803
jgi:Cyagr_0959 111 SGILYPL------KAppVGMVALRSATILGIEAgSGTLSAVGFLRAYPNeevaiN 159 Cyanobium gracile PCC 6307
jgi:Cyagr_2393 104 ARILFPL------RApeAGVPALRAAMVLGTYEgKGSLSAITFLRAYPTrelevs 152 Cyanobium gracile PCC 6307
WP_011936946    95 SAIVYPL------RApdAGVVAMRSALVLGVYDnGGKLTPISFLKAYPAdemavN 143 Synechococcus sp. RCC307
Q7V9E9         104 SKIIYPYr----IPEesISIVALKAATIEAIAKgDETINIISFIKAYPSkviaiD 154 Prochlorococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap