Conserved Protein Domain Family
Ureide_permease

?
pfam07168: Ureide_permease 
Ureide permease
Heterocyclic nitrogen compounds may serve as nitrogen sources or nitrogen transport compounds in plants that are not able to fix nitrogen. This family represents ureide permease, a transporter of a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine; it has 10 putative transmembrane domains with a large cytosolic central domain containing a 'Walker A' motif. Ureide permease is likely to transport other purine degradation products when nitrogen sources are low. Transport is dependent on glucose and a proton gradient. The family is found in bacteria, plants and yeast. These transporters are constituted of two sets of 5xTMs.
Statistics
?
PSSM-Id: 399863
View PSSM: pfam07168
Aligned: 14 rows
Threshold Bit Score: 563.165
Threshold Setting Gi: 300158599
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EES17067      41 TFLDFSVTNFLAAVLVALTFGQIGpdtPETPNFLTQLAQvqNNWPSVLFAMAGGVTLSLGTLATQYGWAFVGLSVTEVMA 120 sorghum
EFH51470      41 TYLDYSITNLLAAIIIAFTFGQIGstkPDSPNFITQLAQ--DNWPSVMFAMAGGIVLSLGNLATQYAWALVGLSVTEVVT 118 Arabidopsis lyr...
EFJ12276      41 TYLDYCITNYIAAIVIALTLGQIGessTQTPNFLEQLKQ--DNWPSVGFAMAGGIVLCLGNLSLQYALAYVGLSVAEVIS 118 Selaginella moe...
XP_003576090  41 AYLDYSVSNLLAAVLIALTFGQLGd---GRPNFFTQLRQaqDDWPSVLFALGGGAALSVGNLCTQYGWAYVGLSLTEVIV 117 stiff brome
XP_015619377  41 TYLDYSVTNLLAAAVIAITFGQVGetrPSMPSFFTQLTQ--DNWPSVLFAMAGGIALSIGHLISQYAWAFVGLSVTNIIC 118 Japanese rice
Q2QQ90        41 TYLDYSITNFLAALLVAFTFGQIGadtPETPNFLTQLTQmqDNWPSILFAMSGGIFNGLGTLATQYGWAFVGLSVTEVMA 120 Japanese rice
XP_014757277  41 TFLDFSLTNFLAAVLVGLTFGQIGpdsPDTPNFLTQLARpqDTWPSILFAMAGGVVISLGTLATQYGWAYVGLSVTEVMA 120 stiff brome
EFH51469      41 TLLDFATANLLAAIVIAFSLGEIGkstFRKPDFTTQLPQ--DNWPSVLLAVAGGVLLSIGNLATQYAFAFVGLSVTEVIT 118 Arabidopsis lyr...
KRH75038      68 TYLDYSITNFLSALLIAFTLGGIGkgtHDQPNFLVQLAQ--DNWPSVLFAMGGGLFLSLGNLSSQYAFAFVGLSVTEVIT 145 soybean
XP_002311338  41 TYLDYSITNLLAAVIIALTFGEIGs---GRPNFTTQLSQ--DNWPSIMFAMAGGVVLSLGNLSTQYAWAFVGLSVTEVIT 115 black cottonwood
EES17067     121 SSLKVVIGTTLNYFLDGRINKAEILFPGVGCFLIAAILGSLVHASNAADNQEKLANSLAKYSKNTRkntaddedltkhll 200 sorghum
EFH51470     119 SSITVVIGSTLNYFLDDKINKAEILFPGVACFLIAVCLGSAVHRSNADDNKAKLRDFEMAKQEASGpsteig-------- 190 Arabidopsis lyr...
EFJ12276     119 CSITVVAGTTMNYFLDDRINRAEILFPGVACFLIAVFLGSALHSSNTKDNRAKLAAAELLNSNDGSgssykrldvemaav 198 Selaginella moe...
XP_003576090 118 SSLTVVVGTTLNYFLDNKINSAAILFPGVACFLAAATLACALHSSNKADDKKKLSASPNSYSFCTNggltlgeq----vs 193 stiff brome
XP_015619377 119 SSLAVVLGTTMNYFLDGRINRAEILFPGVACFLVAIFLGSAVHSSNAKDEEEKLSMSRGIELSSDVadqvkl-------- 190 Japanese rice
Q2QQ90       121 SSLKVVIGTTLNYFLDGRINKAEILFPGVGCFLIAACLGSLVHSSNAADNQEKLSSAMVNHSNTNGdteneeltk--hll 198 Japanese rice
XP_014757277 121 SSLKVVIGTTLNYFLDGRINKAEILFPGVGCFLVAACLGSLVHSSNAADNQEKLSRSRHATTGNTAneeltknl----ld 196 stiff brome
EFH51469     119 ASITVVIGTTLNYFLDDKINKAEILFPGVGCFLIAVFLGAAVHASNAADVKAKLKSLPSEYKAETKdfysstknv--edn 196 Arabidopsis lyr...
KRH75038     146 ASITVVIGTTLNYFLDDKINKAEILFPGVGCFLIAVFLGSAVHSSNAADNKAKLSNFTGDYKDGDIssskeg-------- 217 soybean
XP_002311338 116 SSITVVIGTTLNYFLDDKINKAEILFPGVGCFLIAVCLGSAVHSSNAADNRAKLKGLTSDNKNVTEtvgssaysn--eas 193 black cottonwood
EES17067     201 nkeipkDPEAAKpdaadqatEAPEKVEAGTAEFLVNLEEKRSIKVLGSHTLLGLGIVVFAGVFYALFAPALNLSTNDQWH 280 sorghum
EFH51470     191 -tnsskDLETNVt------dETSTKPKEGTARFLIELENKRAIKVFGKRKIIGLAITFFAGLCFSLFSPAFNLATNDQWH 263 Arabidopsis lyr...
EFJ12276     199 etknqpEEENGT--------TKTVKAQAGTAEFLDQLEHKRAIKNTTSNTILGLGIIFFAGACFSLFSPAFNVATNDQWH 270 Selaginella moe...
XP_003576090 194 iteplrDTENGDsp-----vTDATRAKPGSKEYLIELEQRRSIKVLESNKFIGIAIVLFAGFLMSLFSPAFNLATNDQWH 268 stiff brome
XP_015619377 191 -lpnqeELENGE----------DDDFDTGTAEFIVQVEKRRSIKVFGSSRWLGLGMVLLAGVCFSLFSPAINLATNDQWR 259 Japanese rice
Q2QQ90       199 eieqpkDCEEQEpeva-paaQAVEKLEAGTADFLVDLEGKRSIKVLGSNTFLGLGIVTFAGVSYSLFSPAFNLATNDQWH 277 Japanese rice
XP_014757277 197 keekpkDCEEAKpd----epKAVEKIEAGTADFLIHLEDKRSIKVLGSHTLVGLGIVTFAGICYSLFSPAFNLATNDQFH 272 stiff brome
EFH51469     197 pekeknDVESQE--------KQAGKAKAGTAGFFVELENKRAIKVFGKSIMIGLFITLFAGTCLSLFSPAFNLATNDQWS 268 Arabidopsis lyr...
KRH75038     218 divkskDLESGS--------SSADNVEAGTAVFLVELEEKRAIKVFGKSTLIGLALTFFAGLCFSMFSPAFNIATNDQWN 289 soybean
XP_002311338 194 qnkgvkDMENGS--------STPERAKAGTADFLIELENRRSIKVFGRSTLIGLSITFFAGFCFSLFSPAFNLATNDQWH 265 black cottonwood
EES17067     281 ALPAGVPHLVVYTAYFYFSLACLAVSAALNVWLLYRPImAGVPASStVSAYLRDGGe-GRAPAMLAGMVCGLGNAFTFMA 359 sorghum
EFH51470     264 RLKQGVPKLVLYTAFFYFSVSCFIIALILNIGFLYHPV-LGLPKSS-FKAYLNDWN--GRYWAFLAGFLCGFGNGLQFMG 339 Arabidopsis lyr...
EFJ12276     271 TLKPGVPRLVVYTAFFYFSTSFFVLALFLSLVLLYRPA-VGLPKSS-LTAYVADWN--GRPWALLAGLLCGFGNGLQFMG 346 Selaginella moe...
XP_003576090 269 TLKDGVPHLMVYTAYFYFSISSFVIGVGINIWFLYCPI-ADVEKSS-FKAYLKDWK--GRQWALLAGLLCGFGNGLEFMG 344 stiff brome
XP_015619377 260 TLRDSVPHLTVYTAFFYFSVSCFAVGIGLNARLLYRPV-AGVPPST-IGAYAGDWN--GRHWALLAGLLCGFGNGFQFMG 335 Japanese rice
Q2QQ90       278 TLGEGVPHMVVYTAFFYFSLACFAIGIALNIWFLYHPM-VGVPRSS-LTAYLKDWK--GRDLALVAGMVCGLGNAFQFMA 353 Japanese rice
XP_014757277 273 LLPGTAPHLGIYAAYFHFSLSCFAVGVGLNLWFLYRPM-AGVPQSS-LRAYIHDPDtgGRALALLAGMVCGLGNAFTFMA 350 stiff brome
EFH51469     269 TLPKGVPKLVVYTAFFYFSIAGFLIALILNIIFLYRPM-VALARSS-LKKYIYDSK--GRGWAVFAGFLCGFGNGLQFMG 344 Arabidopsis lyr...
KRH75038     290 TLKKGVPHLTVYTAFFYFSISCFVIAMILNITFLYHPV-LNLPKSS-FKAYLADSD--GRVWALLAGLLCGFGNGLQFMG 365 soybean
XP_002311338 266 TLKKGVPKLVVYTAFFWFSVSCFVLAIILNVTFLYRPV-LNLPRSS-LKAYVNDWN--GRGWAFLAGLLCGFGNGLQFMG 341 black cottonwood
EES17067     360 GQAAGYAAADSVQALPLVSTFWGVVLFGEYRRSSRRTYTLLASMLLMFTVAMVLLMAS 417 sorghum
EFH51470     340 GQAAGYAAADSVQALPLVSTFWGVVLFGEYRRSSRKTYLLLFSMLFMFISAVAVLMAS 397 Arabidopsis lyrata subsp. lyrata
EFJ12276     347 GQAAGYAAADAVQAMPLVSTLWGVLFFGEYIRSSRRTYMLLAAMLTMFCIAVAVLMAS 404 Selaginella moellendorffii
XP_003576090 345 GQAAGYAAADAVEALPLVSTFWAILLLKEYWRASKKTYILLVSMLFTFAAAVALLMGS 402 stiff brome
XP_015619377 336 GQAAGYAAADAVQALPLVSTFWGVILFGEYRRSSRKTYLLLGCMLSMFIVAVVLLMAS 393 Japanese rice
Q2QQ90       354 GQAAGYAAADAVQALPLVSTVWGIVLFGEYRRSSRRTYTLLGSMLFMFVVAMVILMAS 411 Japanese rice
XP_014757277 351 GQAAGYAAADAVQALPLVSTFWGVVLFGEYRRSSRRTYVLLGSMLFMFVVAMVVLMAS 408 stiff brome
EFH51469     345 GQAAGYAAADSVQALPLVSTFWGIVLLGEYRRSSKRTYALLVSMLAMFVAAVAILMAS 402 Arabidopsis lyrata subsp. lyrata
KRH75038     366 GQAAGYAAADAVQALPLVSTFWGVILFGEYRKSSRRTYILLGSMLFMFIVAVAVLMAS 423 soybean
XP_002311338 342 GQAAGYAAADAVQALPLVSTFWGILLFGEYRKSSRRTYILLVNMLFMFIAAVGILMAS 399 black cottonwood
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap