Conserved Protein Domain Family
PhaC_N

?
pfam07167: PhaC_N 
Poly-beta-hydroxybutyrate polymerase (PhaC) N-terminus
This family represents the N-terminal region of the bacterial poly-beta-hydroxybutyrate polymerase (PhaC). Polyhydroxyalkanoic acids (PHAs) are carbon and energy reserve polymers produced in some bacteria when carbon sources are plentiful and another nutrient, such as nitrogen, phosphate, oxygen, or sulfur, becomes limiting. PHAs composed of monomeric units ranging from 3 to 14 carbons exist in nature. When the carbon source is exhausted, PHA is utilized by the bacterium. PhaC links D-(-)-3-hydroxybutyrl-CoA to an existing PHA molecule by the formation of an ester bond. This family appears to be a partial segment of an alpha/beta hydrolase domain.
Statistics
?
PSSM-Id: 399862
View PSSM: pfam07167
Aligned: 24 rows
Threshold Bit Score: 258.346
Threshold Setting Gi: 81554762
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCC97997      108 DDRRFKDSAWDENTLFDFIKQSYLLSARWMQSTVNEVDgLDDHTAKKVDFYTRQFVDAMAPSNFVMTNPEVLRTTIETGG 187 Azospirillum b...
Q87GW3         94 GDKRFSNEAWQNEAMYSFIKQSYLLFSKTYLDTIESLEgLDEKTKERIIFFSRQAINALSPSNFIATNPELLKLTLEQNG 173 Vibrio parahae...
Q9ZHI2         71 ADRRFASPEWNEHPFYNFLKQSYLQTSKWMMELVDKTQ-LDEDAKDKLAFATRQYLDAMSPSNFMLTNPDVVKRAIETKG 149 Chromobacteriu...
Q89NV2         85 GDRRFNATEWRDDAAYSLLKQCYLLNSRYCVDFVEALD-LDEKEKHRLRFFTRQLIEAMSPTNFLATNPDVIKLATDSEG 163 Bradyrhizobium...
Q8XYX5        107 SDRRFANDAWRKSPLYGYAAAFYVLNARTLMDMADAVQ-ADAKTRERVRFAVSQWTAAMSPSNFLATNPEAQKQLIESRG 185 Ralstonia sola...
jgi:Daci_3600 101 KDKRFNTESWAGNPLTAATAATYLLNSRMLMGLADAVQ-ADDKTRNRVRFAIEQWLAAMAPSNFLALNAEAQKKAIETQG 179 Delftia acidov...
WP_003095864   75 DDRRFSDPAWSQNPLYKRYMQTYLAWRKELHSWISHSD-LSPQDISRGQFVINLLTEAMSPTNSLS-NPAAVKRFFETGG 152 Pseudomonas
Q88D23         75 RDARFSDPTWSQNPFYRRGLQAYLAWQKQTRQWIDESH-LNDDDRARAHFLFNLINDALAPSNSLL-NPLAVKELFNTGG 152 Pseudomonas pu...
WP_016495137   75 QDSRFADPSWQHNPFYRRGLQVYLTWQKQLGAWIEESD-LSDDDRARARFVLAQLSDALAPTNSLL-NPLAVKELFNTGG 152 Pseudomonas re...
AAG08443       75 QDARFQDPSWRLNPFYRRTLQAYLAWQKQLLAWIDESN-LDCDDRARARFLVALLSDAVAPSNSLI-NPLALKELFNTGG 152 Pseudomonas ae...
CCC97997      188 ENLVKGLEHLLKDLERGKGELRISMTDYDAFQVGKNIAVTPGKVVFQTDLMQLIQYTPTTPEVNKRPLMIVPPWINKYYI 267 Azospirillum b...
Q87GW3        174 QNLLAGLEQLKEDVESSADILKVRMTNNNAFRVGDDVATTAGDVVFQNELFELIQYRPLTEKVNATPLLIVPPFINKYYI 253 Vibrio parahae...
Q9ZHI2        150 ESLVEGMKNMLDDFQKG----HISMSDESKFEIGKNLVVTPGQVVFRNELIELIQYTPTTDKVYEKPLLFVPPCINKYYL 225 Chromobacteriu...
Q89NV2        164 QSLKAGLENLMSDLGRG----SLTITDEEAFEVGKDVAASRGAVVFENELFQLIQYAPATEQVAARPLLIVPPCINKFYI 239 Bradyrhizobium...
Q8XYX5        186 ESLRAGILNMLQDMERG----KISQTDETAFEIGRNVANSEGAVVFENDYFQLIQYKPLTAKVHARPLLLVPPCINKYYI 261 Ralstonia sola...
jgi:Daci_3600 180 ESLAQGVANLLADMRQG----HVSMTDESLFTVGKNVATTEGAVVFENELFQLIEYKPLTDKVHERPFLMVPPCINKFYI 255 Delftia acidov...
WP_003095864  153 KSLLDGLGHLAKDLVNNGG--MPSQVDMDAFEVGKNLATTEGAVVFRNDVLELIQYRPITESVHERPLLVVPPQINKFYV 230 Pseudomonas
Q88D23        153 QSLVRGVAHLLDDLRHNDG--LPRQVDERAFEVGVNLAATPGAVVFRNELLELIQYSPMSEKQHARPLLVVPPQINKFYI 230 Pseudomonas pu...
WP_016495137  153 FSLIKGLSHLVDDLLHNDG--MPSQVSKHAFEIGRNLANTPGAVVFRNELLELIQYKPMSEKQYLRPLLVVPPQINKYYI 230 Pseudomonas re...
AAG08443      153 ISLLNGVRHLLEDLVHNGG--MPSQVNKTAFEIGRNLATTQGAVVFRNEVLELIQYKPLGERQYAKPLLIVPPQINKYYI 230 Pseudomonas ae...
CCC97997      268 LDLREKNSFIKWA 280 Azospirillum brasilense Sp245
Q87GW3        254 LDLTAKNSMVRWL 266 Vibrio parahaemolyticus
Q9ZHI2        226 MDLQPDNSMVRHF 238 Chromobacterium violaceum ATCC 12472
Q89NV2        240 LDLQPANSFVRFA 252 Bradyrhizobium japonicum
Q8XYX5        262 LDLQPANSLVRYS 274 Ralstonia solanacearum
jgi:Daci_3600 256 LDLQPDNSLIRYA 268 Delftia acidovorans SPH-1
WP_003095864  231 FDLSPDKSLARFC 243 Pseudomonas
Q88D23        231 FDLSATNSFVQYM 243 Pseudomonas putida KT2440
WP_016495137  231 FDLAPDKSFVQYA 243 Pseudomonas resinovorans
AAG08443      231 FDLSPEKSFVQYA 243 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap