2HH8


Conserved Protein Domain Family
DUF1398

?
pfam07166: DUF1398 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1398)
This family consists of several hypothetical Enterobacterial proteins of around 130 residues in length. Members of this family seem to be found exclusively in Escherichia coli and Salmonella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399861
View PSSM: pfam07166
Aligned: 13 rows
Threshold Bit Score: 152.472
Threshold Setting Gi: 497738233
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HH8_A          15 IFDKVRNDLNYQWFYSELKRHNVSHYIYYLATENVHIVlKNDNTVLLKGLKNIVSVKFSKDRHLIETTSNKLKSREITFQ 94  Escherichia coli
WP_010052417    11 IINNETNAGGFAELIKNFKEIGVSHYEYRVAAGMYRYY-DEDSSIDIQFNGIPKPVVPIESAEKIKQAVKRAQAGEITFE 89  Carnobacteriu...
Q38X56          10 AVDAEQNASDFPKLMQAFKKMGVLKYDYLVESGKYRYY-DNDGYLDFKMNGVPQKVAPKSNATQIKAAVQKAQTGQITFE 88  Lactobacillus...
Q11NI3          10 AHAKVKSGADFPSYIQELIGLGLKQYTQFVSDGHTIYSgTDNVTIQSEAKYPAFTIAEKADKAKLKQDLGIHQQGGTNYM 89  Cytophaga hut...
jgi:Fluta_3812  10 AHKKVKSGAEFPQYIQEIKRFGVKSFETWVSDSHTVYFgESGFQTESQPKYEKLTVADRTDIDQFKVRLKIHQQGQTDYY 89  Fluviicola ta...
jgi:Emtol_2746  10 AHAKVKSGADFPAYIQEIKAFGVTYYEAFVADGRIVYFgENNFQITAPAKYEPLLLADVCNAEQFKADLLAHQQGQTNYQ 89  Emticicia oli...
WP_014388284    10 AHGKVKSGADFPAYIQEIKQMGVTHYEAYVTDGHTDYHgGSDFMVTVPAKYEPLVIADVPNLEVFKSELIAHQQGKTDYL 89  Flavobacteriu...
P75988          10 MFEQVRKEQNFSWFYSELKHHRIAHYIYYLATDNIRIItHDDTVLLLRGTRNLLKVSTTKNPAKIKEAALLHICGKSTFR 89  Escherichia c...
P77598          10 IFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIHIVlENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQ 89  Escherichia c...
jgi:Cpin_6356   10 AHAKVKTGADFPRYVQEIKGMGLRRYEYLVQDGTTVYYgDDNHQVESIPIYDPQEINSSSSAAALRHTIAIHQQGQTDFL 89  Chitinophaga ...
WP_004224558    10 FFEQARSDADYATFANELRRHQVSYYIYFVSTGNMNFVmANDEVVSVKSARGLLRVRAEASHCLTRAAVIRHFARAINFE 89  Enterobacteri...
WP_002443598    10 FFEQVRSNADFPSFITELRRNDISYYIYFVATGNVKIVtTSDTYMSVKTHRGLIKINQAACSRLVRIVSRRHFSGKTTYD 89  Shimwellia bl...
Q8ZNY7          10 FFERVRKDANFNAFLIDLEYNNIAYYIYFVATGNVKIItHAGHFISIKSNRKLIKVNSTPNTQLIKLISAKHFSGEHSYE 89  Salmonella en...
2HH8_A          95 EYRRNLAKAGVFRWVTNIHEQKRYYYTFDNSLLFTE 130 Escherichia coli
WP_010052417    90 QFTELAGEAGIAYWATDISKMVVNYYGIQGSLLLSE 125 Carnobacterium maltaromaticum
Q38X56          89 VFCELAAAAGIIYWRSDLTQKVVSYYDRTDDCLLAE 124 Lactobacillus sakei subsp. sakei 23K
Q11NI3          90 TFCEQAAAAGVETWIVDMHNMTCIYYDKSGNEMLAE 125 Cytophaga hutchinsonii ATCC 33406
jgi:Fluta_3812  90 TFCKDCAKTGVEKWIMDLNAMTCIYYDKQGNELLLE 125 Fluviicola taffensis DSM 16823
jgi:Emtol_2746  90 TFCNDCAKSGIEKWAVCFEKMTCTYFDKANHEILIE 125 Emticicia oligotrophica DSM 17448
WP_014388284    90 TFIRMCAETGIEKWEICLSQMTCTYFDLAGKVVLVE 125 Flavobacterium indicum
P75988          90 EYCSTLAGAGVFRWVTDVNHNKRSYYAIDNTLLYIE 125 Escherichia coli K-12
P77598          90 QYRENLAKAGVFRWITNIHEHKRYYYTFDNSLLFTE 125 Escherichia coli K-12
jgi:Cpin_6356   90 TFCQQAANAGVEKWVIDTERMVCTYLDKNGAVLIEE 125 Chitinophaga pinensis DSM 2588
WP_004224558    90 QYCRDLASAGVFKWIVDLEEETRHYWSKDNTLLYKE 125 Enterobacteriaceae
WP_002443598    90 QYCKELAKAGVFKWVVDVNEQMRHYWSKDNQLLHSE 125 Shimwellia blattae
Q8ZNY7          90 KYCTDLATAGVFKWIVELNQKTRQYWSKDNQLLYIE 125 Salmonella enterica subsp. enterica serovar Typhimurium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap