Conserved Protein Domain Family
Pex26

?
pfam07163: Pex26 
Pex26 protein
This family consists of Pex26 and related mammalian proteins. Pex26 is a type II peroxisomal membrane protein which recruits Pex6-Pex1 complexes to peroxisomes. Mutations in Pex26 can lead to human disorders.
Statistics
?
PSSM-Id: 399859
View PSSM: pfam07163
Aligned: 11 rows
Threshold Bit Score: 411.052
Threshold Setting Gi: 41053983
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_956214      1 MRSSSSVSPAGGRGSGSVRLVSPL------GCPLTALIDAAVEYLMVKKDFHAALATCEKGLESLDSFAEQ--EESCFKH 72  zebrafish
Q7Z412         1 MKSDSSTSAAPLRGLGGPLRSSEPvravpaRAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVA--EEPAGTS 78  human
ELK02627     144 MKSDLSTSAAPLKGVGGPLRSSEPvrivpaPSPAVVLLEEAADLLVVHLDFPAALQTCERAWQSLANGALA--DEPTGTF 221 black flying fox
Q8BGI5         1 MKSDASTSAAPLKGLVGPLRSSEPalalpaVSPAVHLLEEASDLLVVHLDFHAALETCERAWQSLAEEPV------SGTI 74  house mouse
XP_004083131   3 SCSSRQTPCSF-----GSVSSSPPps--saALQMINMLDSAAEQMMVYRDFQAVFDTCQRGLEKLAG--------TEDNR 67  Japanese medaka
EHB13701     262 MKSDAAISAGPLKGLGGPLRSSERartamaASPVVHLLEEAADLLVVHLDFPAALETCERACQSLARDALG--EEPAATS 339 naked mole-rat
XP_015208499   1 MRSSSSNSLAHVRGLGSVRLGSSPlls-qgSAQALSLLETAAEQLMVQRDFRAALDSCERGLDSMGSVPEQ--EDTSSNF 77  spotted gar
XP_005456724   1 --------------mnsfqAASPPls--aaVTQMFNTLESAAEQMMVHRDFQAAFDTCLRGLESLDG------LEPEDSR 58  Nile tilapia
XP_005988708   1 MRSLSSTSFVMPRGLGMTRPGSGLals-vgSAQALSLLDRAADLLAVQRDFAAAVETCEQGISCVDS---S--NDNEENY 74  coelacanth
XP_003220855   1 MRDDFSGALAAIAGSGGLLRSSEPlslspvLSPAASLLEDAADLLVMRKDFAAALEKCEKGCQSLED------GDPNSS- 73  green anole
XP_022266580   1 MKSDSASPAAAL-GLWGPVRSSEParaapaAAAAAALLEDAADLLVVHLDFRAALRTCERAWRSLGNHSXTxiGFSAGSS 79  dog
NP_956214     73 --AELRSAFTIIGVQALAELNQWRTVLSWVLQQYGETENIPAKIIQMCILLYVKVGERAVMKEAVCDWLHCSGNASQSGF 150 zebrafish
Q7Z412        79 --LEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEY 156 human
ELK02627     222 --SEVKCSLCVVGIQALAEMDRWREVLSWVLQYYQIPEKLPPKVLELCVLLYSKMQEPGAMLEAANAWLQDPDNLGLPEY 299 black flying fox
Q8BGI5        75 --VEVKCSLCVVGIQALAEMDRWREALSWVLRYYQVPEKLPPKVLELCILLYSKMKEPGAVLDVASAWLQDPDNQGLPDY 152 house mouse
XP_004083131  68 c-TELKTGFCILGIQALAELNRWHGVLAWVLQQYERQEDIPAKIMQMCILLYSKVGEAAEMQEAASVWLNCPSNCGSAGF 146 Japanese medaka
EHB13701     340 --LEVKCSLCVVGIQALAEMDRWREVLSWVLQYYQVPEKLPPKVLELC-----KMQEPGAMLNVVSAWLQDPDNQGLPEY 412 naked mole-rat
XP_015208499  78 rcSEVKVALCTIGVQALAELNQWRGVLPWILQYYGTPEKIPAKIMQMCILLYTKVDEPAVVLQAGGDWLRSPANQSLPGY 157 spotted gar
XP_005456724  59 c-AELKAGFCILGIQALAELNQWRDVLCWVLQQYE-QEKIPAKIMQMCILLYSKVGEPAVMQEVTRAWLHYPSNSRATSF 136 Nile tilapia
XP_005988708  75 rcSEVKVCLCVIGIQALAELNRWQEVLSWVLRYFQVPAKMPAKIIQLCILLHSKVEEPQAMLAVGREWLTDLANQSLPTY 154 coelacanth
XP_003220855  74 --EELKCSLSIVGIQALAEMDRWRDVLPWILQYYQDPECWPPKILELCILLHSKVEEPQAMLEIGSDWLHSSTNQHLPSY 151 green anole
XP_022266580  80 --LEVKGSLCVVGIQALAEMNRWREVLSWVLQYYQVPEKLPPKVLELCVLLYSKMQEPGAVLEVVSAWLQDPDNQGLPEY 157 dog
NP_956214    151 STVAELYFLHILLPMGHVTEALEMLESdvgLVAFTDEQRQAARSLVDDQNQ---------------KnassSSSSSSNTN 215 zebrafish
Q7Z412       157 GALAEFHVQRVLLPLGCLSEAEELVVG---SAAFGEERRLDVLQAIHTARQ---------------Q----QKQEHSGSE 214 human
ELK02627     300 RTLAELHLHRVLLPLGYLSEAEKLVVD---PAAFSEEQRLDALQAISTARQ---------------Q----QKHEHSHSE 357 black flying fox
Q8BGI5       153 GSLARLHVFRLLLPSGRLSEAEELAVR---SAAFSEEQRVEALQAIHLARQ---------------QhtqeHTQEHSDSQ 214 house mouse
XP_004083131 147 RTVAELYLLHILVPLGHFEEAREFIAGevgGIAFA-ERKQAALNIVEEKAQ---------------Q----SREAALRSG 206 Japanese medaka
EHB13701     413 GILAELHLQRVLLPLGHLAEAEELVVG---SAAFGEQQRLEMLQAVRTAKQ---------------Q----QKQERSGFQ 470 naked mole-rat
XP_015208499 158 GAVAELYLLHILVPLGRLGEAQALAES---STAFSEEQRQVAVDIIEHKRS---------------S----SQPQSPSQA 215 spotted gar
XP_005456724 137 RTVAELYLLHVLVPLREADEARELIRGevfSSAFTEEHRQTALDIIEEKER---------------Q----NQDPPLNPR 197 Nile tilapia
XP_005988708 155 STVAELHLLHILLPLGLFAEAEDLAKN---PASFCAEQRRVALEVVRQRKErhveleepktltalnR----QQSDRSTVR 227 coelacanth
XP_003220855 152 GLLVQLYLFHVLLPLGHLAEAEGLLQG---CKALSEHQQAEAHESIEEKKH---------------Qwl-rQQEECLVPE 212 green anole
XP_022266580 158 RALAELHLQRVLLPLGYLSEAEELVVG---SAAFSEEERLDVLQDIRKAKQ---------------Q----QKHQHLGSE 215 dog
NP_956214    216 SDSVdvmetssVS-----KQGRLTLRLNSIIKLLSRGLSVASVRIRSISLRRVFLALMLLYLLIARLDPALPSALPWLLR 290 zebrafish
Q7Z412       215 EAQK-------PN-----LEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYK 282 human
ELK02627     358 ENQK-------LN-----QEGSFSNKFLSLLMLLRRLWDSTVSHFFALPFRKSLLAALILCLLVVRFDPASPSSLPILCK 425 black flying fox
Q8BGI5       215 EPQK-------LR-----QEGSFSQKLLSLLMLLRRLWGSVVSHLLSQPFRKGLLAALILCLLILRFDPAAPSSLPFLYQ 282 house mouse
XP_004083131 207 IHPAseisahpNS-----VKDAIIHKLEAMLRFLYRKILTAGSG--LFPLRRLFLIAVILYMLFSRLDPAAPSSFMWISK 279 Japanese medaka
EHB13701     471 EVPK-------TN-----QEGSFSHKFLSLLMLLRRLWDSAVSHFLSLPFKKSLLAALILCFLVMRFDPASPPSLPFLYQ 538 naked mole-rat
XP_015208499 216 QELEhkicrsaVS-----------QRLDSTVRLLYRALFLVRKRFRAFPFQKTVLAAVLLYLLLIRVDPAVPSAFPWISN 284 spotted gar
XP_005456724 198 MSGSsdvtehpVS-----SQgtlVHKLEAVIRFLYRKLLMIGSG--SFPFRRIFLTAILLYMLFFRMDPALPSAFMWISK 270 Nile tilapia
XP_005988708 228 QE---------DS-----ETGFRSQKLLAMIRLFQRALVLIRSRLRSFHLQRMILATFLLYLVVIRLDPASPSTLPWISK 293 coelacanth
XP_003220855 213 EPPD-------VAwkqhlGLA--SQKMLTVLAQLGRVVGSLAGQLCSIPYKKTLLAAVMLCLIIVKLDPASPTSLPFIYR 283 green anole
XP_022266580 216 EAQK-------LN-----QEGSFSHKFLSLMMLFRRLWDSIVSHFFSMPFKKSLLAALILCLLVVRFDPASPSSLPFLYK 283 dog
NP_956214    291 LHGLLQQMFNTMFGPYYKAH 310 zebrafish
Q7Z412       283 LAQLFRWIRKAAFSRLYQLR 302 human
ELK02627     426 LAQIFHWIREAMFSSFYQLp 445 black flying fox
Q8BGI5       283 LTQLFRRIQKATLSRLYPLA 302 house mouse
XP_004083131 280 LCQLFKQMWRTMFGPYYQTL 299 Japanese medaka
EHB13701     539 LAQLLHRIRKAMFAHLYQLR 558 naked mole-rat
XP_015208499 285 LLQIFRQMWDTMFAPYYRAA 304 spotted gar
XP_005456724 271 LLQLLKQMWNAMFAPYYQAV 290 Nile tilapia
XP_005988708 294 LLRIFRHLWNSMFAPYYKAK 313 coelacanth
XP_003220855 284 VLHLFHQARLAVFSshcrpp 303 green anole
XP_022266580 284 LAQLFHRIQEGMFS-LYrlp 302 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap