Conserved Protein Domain Family
DUF1394

?
pfam07159: DUF1394 
Protein of unknown function (DUF1394)
This family consists of several hypothetical eukaryotic proteins of around 320 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399855
View PSSM: pfam07159
Aligned: 34 rows
Threshold Bit Score: 334.972
Threshold Setting Gi: 123491023
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPB83473                  20 EINFDIENARPSSE-ELGIYNQLHALLvQPNSNLLKILKEY-KPASDEIRNAIATPN--------QENEDKAWNAILPTV 89  Muc...
EFP07843                  32 EIFVDFENAQPTNE-EREIYNMAEEVL-HDCDVVLADVSSYgNGCYIE-RSQLKNDSd-------TQALKILMTKLEPFV 101 Cae...
EGF81405                  19 dIPIDF-NAQPTPE-EQQIYNSASEIL-SFAPNILQDLRNY-TGCGEAIRQAISTPG--------RATEDAAWAVVCPAV 86  Bat...
EPB90899                  19 eLGFDLENATPSSD-ELQLYNKLSSLLvKPGPALLHLLKSY-VPASDQIRDAIAKPT--------PENESRAWDAVSPTV 88  Muc...
EIE80432                  19 EIGFDIENAAPTTE-ESEIHDELYNLLiQPTTELLQSFRQY-EPASDMIREAIASPT--------TENEDKAWEAVTPTV 88  Rhi...
Q8T2H0                    16 QIFIDFEHAQPSDD-ERELHKTVNEVL-IRGPAIIDKLLAY-AGCNEFIRRAITNPG--------PETEDAAWEAVLPSV 84  Dic...
XP_001325741              13 AVYIDLKNATPTNDvERKIVEDFQEKVlNPGKNLYDKFANY-KDGQEFVKIAMRDTS--------QANKDAAWNAILPNV 83  Tri...
WGS:AAFB:cds.EHI_131000A   9 vaipinfSATPSAA-EQEPFQTINEVA-SHINEMLQKMTNY-KAKETEIRAAIATPS--------PETEEAAWKAIIPQV 77  Ent...
BAN39491                  16 QITIDFENVSPSEA-ELKIWNDIDIML-RRKDDVLNKVTNY-HGQDDLIRKAISARTgsdnlsgmSQPEEEAWKVISSQA 92  Ent...
XP_003241353              34 DIFLDFENAQPTES-EMELFDEVQIVL-TEASDVLSDLKHY-LGADQYIRAAINNPS--------AEQNALTWEALMPRI 102 pea...
EPB83473                  90 DALREFYSYSSELERGIPMLLNVLCKDGGGTTK-DLDRHPGLTRLFAEILDFVFEFDYLKIRNPTIQNDFSFYRRTLQ-R 167 Muc...
EFP07843                 102 ARTCSYYEHVAKIEKIVPILLWELSSGPLPLEE-QLANKQSIAKQFARLIGFVLDFDVVKMKTAQITNDYSYYRRAKH-- 178 Cae...
EGF81405                  87 VKLKEFYDFSSSIEQLVPRIWQFFG--KGDVSA-SFEKYQATARRLAEILDFATQFDGLKMSNPNVQNDFSYYRRSVS-R 162 Bat...
EPB90899                  89 DILRDIYDYSADLQEGLPKLLGVLC--QGDVSK-NLERNQGLAKLFAELLDFVFEFDHLKMRSPTLQNDFSYYRRMLQ-R 164 Muc...
EIE80432                  89 NMLRTFYSYSAQLEKGIPTLLNVLC--KDGTTK-DLDRHPGLTKLFADLLDFVFEFDYIKIRSPAIQNDFSFYRRTLQ-R 164 Rhi...
Q8T2H0                    85 DQLQEFYDFSLELETCFPKLLVALC--KNDPKA-SLSNQQALAKQLADIFDFVLKFDDAKMVNPAIQNDFSYYRRTLN-R 160 Dic...
XP_001325741              84 YTQMDGYYFSSTIATEFVNVMSSVLEIAGAAKVdFFTQYPALTKCFADCFDVCLKFDQIPIKNPFLLNDLAYFRRNCReH 163 Tri...
WGS:AAFB:cds.EHI_131000A  78 QTINSFFEYSRSMKTEVVKSLRLIC--KLNGND-SVTQYQAVTVKLMELIDFAVQFDNKKLANPGLQNDFSYYRRSVG-K 153 Ent...
BAN39491                  93 DIINEFYQFAVLLETEFPKLVTELS--RDDAKA-TLTDKQALCKQLGVILDFVLAFDNKKVTNPGIQNDFSYYRRSFP-R 168 Ent...
XP_003241353             103 RTLRRFYFFSQKIAFVVPQILTEICSDDITPSL-HLENQQALVKQFSEIIEFVLKFDEYKIRTPAIQNDFSYYRRVLM-R 180 pea...
EPB83473                 168 gra-tefTQTTPSSPEKEQrsqsdlrlaMNEDDLAN-------RISLFIAYPTPM-LKCVIDTTTKYVQ--Snqlskcts 236 Muc...
EFP07843                 179 ----------------------------IVYQDFEDqgvpelpQVQMFLCEGNPM-LKALCNGVDSYMH--Thqslpinn 227 Cae...
EGF81405                 163 -------MKMNNAQLVA-----------VVSDDLAN-------KMSLFFAHSSPV-TKALIDATALTISsraisqdaas- 215 Bat...
EPB90899                 165 g------RYSSQDGRDGDDssvsdlrsaMIEDDQAN-------RISLFIAYPTPM-LKCIIDTTTKFVN--Knrlqksvg 228 Muc...
EIE80432                 165 g-----------rSLEDSDpnksnlrtaMDEDDLAN-------RISLFIAYSTPM-LKCLIDTTVKYVQ--Snqstksvs 223 Rhi...
Q8T2H0                   161 -------MKLTKKDANI-----------KIRDELAN-------RMSLFFAYPTPM-MKVLSETTVKFLS--Qdttvprdn 212 Dic...
XP_001325741             164 nhdgsfdNLLTD----------------------SN-------FSTVFWGSRMPFtMKVVSEVQDKYKS--Natqyanvi 212 Tri...
WGS:AAFB:cds.EHI_131000A 154 -------MKQKHREDV------------VLRDEVTN-------QISMFFAFAAPM-ILCLCEALNE-----Diknglsld 201 Ent...
BAN39491                 169 -------MKQFKREDEL-----------KIPDEVAN-------RISMFIANPSPM-MAHLVTIIKGVQNgaInpsfsei- 221 Ent...
XP_003241353             181 ega--svHSFTDQDEDS-----------NSNLNVAN-------KVSLFYAEATPM-LRTLSNVTSQFLN--Kdkrlvdya 237 pea...
EPB83473                 237 e---wlasiwavCYQTLNAN--YKKSSSSSVDTFCLKVMVVSIILYDHIDPSGAFAKNSPINVKSSLKTIQNVNQInrqe 311 Muc...
EFP07843                 228 tt-dvfvtiinvCRFMLANEdcLARLT-DSSKHLCCRVMTGLVILFDHVDQNGAFVSNSSIDMRDVVRLIKSNTTQe--- 302 Cae...
EGF81405                 216 ---dilstlagiAYSTVAKNr------aGNDTGFYLRVMVISIVLYDHVDLAGAFIKTSKISIKSSVKVIQTYGGS---- 282 Bat...
EPB90899                 229 d---wlaalwatCFNTVSK----KRNQNPEISAFCMKVMVVSIILYDHIDPNGAFYKNSPINIKHSVKIIQTITTVksn- 300 Muc...
EIE80432                 224 e---wlssiwavCYQTLSK----KKTNNDSISSFCFKVMVVTIILYDHVDPQGAFSKYSPINVKNSLKIIQTSNNnnn-e 295 Rhi...
Q8T2H0                   213 vt-talatmanvCHDMVEKK----KFTQDDLNMFCLRAMVGSIILFDHIHPQGAFVKKSPVNIKPCIVTLKDSNTQ---- 283 Dic...
XP_001325741             213 n---liglvadcCTSICTKSdnPS----QEICIIALRCLTAAIIIYDSLNPLGAFHHEVRYHYREAVDLLLNYTP----- 280 Tri...
WGS:AAFB:cds.EHI_131000A 202 nlgdwlrtvaysCCVEAQKH--------GSNGIQLLRIMTGCILLYDTVVPTGAFSTKGKFNVLECVRTLQTYQEE---- 269 Ent...
BAN39491                 222 -----lilfanvCNDMVQKG----IFENNETNLFCLRVMTGCIILNDNISELGSFHKKSPIKVKDCIMQLKNFADNvdy- 291 Ent...
XP_003241353             238 i--dmlstmvkvCIRMLETP--TVQFRKQETHLFMLRVLVGLIILYDHVHPNGAFVKTSNIDIKGCVRLLKDQPEEf--- 310 pea...
EPB83473                 312 qsSTSNLICALRYNSKHLNDESTPKGIK 339 Mucor circinelloides f. circinelloides 1006PhL
EFP07843                 303 --QSDCLLAGLRFTTKHYNDSSTPKSLR 328 Caenorhabditis remanei
EGF81405                 283 --ACDTLLNSLRYSTRHLNDETTPKVtk 308 Batrachochytrium dendrobatidis JAM81
EPB90899                 301 eySATNLLSALRYNSKHLNDDTTPKNVK 328 Mucor circinelloides f. circinelloides 1006PhL
EIE80432                 296 qsSTANLISALRYNSKHLNDESTPKAIK 323 Rhizopus delemar RA 99-880
Q8T2H0                   284 --SSPGLLNALRFTTIHLNDVDTPGAIK 309 Dictyostelium discoideum
XP_001325741             281 --KQQDLIDIVKYCTTSLSKPTTDSKIK 306 Trichomonas vaginalis G3
WGS:AAFB:cds.EHI_131000A 270 --EVALLANSLKYSTKHFNDEDTPKNIK 295 Entamoeba histolytica HM-1:IMSS
BAN39491                 292 teAINSLLDTIRYTCLHVGDPDTPGYIK 319 Entamoeba histolytica
XP_003241353             311 --QTENLLNALRYTTAHLNDPSTSKTVR 336 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap