Conserved Protein Domain Family
MatC_N

?
pfam07158: MatC_N 
Dicarboxylate carrier protein MatC N-terminus
This family represents the N-terminal region of the bacterial dicarboxylate carrier protein MatC. The MatC protein is an integral membrane protein that could function as a malonate carrier.
Statistics
?
PSSM-Id: 115789
View PSSM: pfam07158
Aligned: 5 rows
Threshold Bit Score: 153.759
Threshold Setting Gi: 81546198
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KIE8   1 MpNELTGVLILAAVFLLAGVRGLNMGLLALVATFLLGVVALDRTPDEVLAGFPASMFLVLVAVTFLFGIARVNGTVDWLV 80  Streptomyces hygrosco...
P72556   1 M-IHLIMISAIALAIGIGYRTKINIDLLAIAFSYLIATTLMGLSPKELLHFWPTSLFFTIFSVSLFYNFAITNGTLDVLA 79  Streptococcus pneumoniae
Q9L0A3   1 MsPELISILVLVVVFVIATTRSVNMGALAFAAAFGVGTLVADLDADGIFAGFPGDLFVVLVGVTYLFAIARANGTTDWLV 80  Streptomyces coelicolor
Q9ZIP4   1 MgIELLSIGLLIAMFIIATIQPINMGALAFAGAFVLGSMIIGMKTNEIFAGFPSDLFLTLVAVTYLFAIAQINGTIDWLV 80  Rhizobium leguminosarum
Q8P4U0   1 MtPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLDGKEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLV 80  Xanthomonas campestri...
Q9KIE8  81 RVAVRAVGARVGAVPWVLFGLAALLCATGAASPAAVAIVAPISVAFAVRHRIDPLYAGLMAVNGAAAGS 149 Streptomyces hygroscopicus subsp...
P72556  80 QHILYRTRTYPNALYMILYLMATLLSALGAGFFTTMAVCCPLAITLCQKVYKHPLIGAQAVNWGASGGA 148 Streptococcus pneumoniae
Q9L0A3  81 HAAVRLVRGRVALIPWVMFALTGALTAIGAVSPAAVAIVAPVALSFATRYSISPLLMGTMVVHGAQAGG 149 Streptomyces coelicolor
Q9ZIP4  81 ECAVRLVRGRIGLIPWVMFLVAAIITGFGALGPAAVAILAPVALSFAVQYRIHPVMMGLMVIHGAQAGG 149 Rhizobium leguminosarum
Q8P4U0  81 HWAVRAVRGRIVAIPWVMFVITGLLTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGG 149 Xanthomonas campestris pv. campe...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap