Conserved Protein Domain Family
Phage_term_sma

?
pfam07141: Phage_term_sma 
Putative bacteriophage terminase small subunit
This family consists of several putative Lactococcus bacteriophage terminase small subunit proteins. The exact function of this family is unknown.
Statistics
?
PSSM-Id: 369228
View PSSM: pfam07141
Aligned: 2 rows
Threshold Bit Score: 322.126
Threshold Setting Gi: 75078002
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AHC30257   1 MQTQKGGRPTILPKMYEEPLFSQIIDKIESGCNDREIYTSLHCSAKTFRKWRDDNIKAYDEAKGIARGNLLELAESALAS 80  Lactococcus phage S...
O80103     1 MQTQNGGRPTILPKMYEEPLFSQIIDKIESGCNDREIYTSLHCSAKTFRKWRDDNIKAYDEAKGIARGNLLELAESALAS 80  Lactococcus virus b...
AHC30257  81 KLTVRTLKETETIYDADGNVEKVKVKEKELDKDSLVAMMVAKAGNPELYNPTEWRRLQQEESSAHDLKAKIEELDDYKLS 160 Lactococcus phage S...
O80103    81 KLTVRTLKETETIYDADGNVEKVKVKEKELDKDSLVAMMVAKAGNPELYNPTEWRRLQQEESSAHDLKAKIEELDDYKLS 160 Lactococcus virus b...
AHC30257 161 KYKTPEIEVPEGFE 174 Lactococcus phage SK1833
O80103   161 KYETPKIEVPKGFE 174 Lactococcus virus bIL170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap