Conserved Protein Domain Family
DUF1381

?
pfam07129: DUF1381 
Protein of unknown function (DUF1381)
This family consists of several hypothetical Staphylococcus aureus and Staphylococcus aureus bacteriophage proteins of around 65 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369223
View PSSM: pfam07129
Aligned: 2 rows
Threshold Bit Score: 81.4719
Threshold Setting Gi: 122539059
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FWS7  2 TQYLVTTFKDSSGLPHEHFTAARDNQTFTVVEAESKEEAKEKYE 45  Staphylococcus aureus subsp. aureus NCTC 8325
Q2FWS7  2 TQYLVTTFKDSSGLPHEHFTAARDNQTFTVVEAESKEEAKEKYE 45  Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap