Conserved Protein Domain Family
DUF1380

?
pfam07128: DUF1380 
Protein of unknown function (DUF1380)
This family consists of several hypothetical bacterial proteins of around 140 residues in length. Members of this family seem to be specific to Enterobacteria. The function of this family is unknown.
Statistics
?
PSSM-Id: 399840
View PSSM: pfam07128
Aligned: 3 rows
Threshold Bit Score: 202.914
Threshold Setting Gi: 502965012
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:KPN_pKPN4p07099   1 MYGTREDLCRMLNEQYPAETPLNLIIWTPADIEALADGMeysfSEHDVRAVLERMDTIPEEQRLESGVSAGLVMALIDQV 80  Klebsi...
WP_013199988            2 MYGTRKEVTRLIKRAFGGEEKLALLVWTEQDVMAQAEDM----TAQEADAILCAIGNAGLYGHMDEGISSRTVRELLAGL 77  Erwini...
Q7ARC0                 25 MYGTCETLCRLLREQYPAETPLNLIVWSPADIEALADGMeyavSEQDTRAVLARMDAIPEEQQLESGVSAGAVMDLIEQV 104 Yersin...
wugsc:KPN_pKPN4p07099  81 KENGQRVTVPVDLLETLLITAEQALWDREWTARDRNLPVPESVMRRLADTAKVRALL 137 Klebsiella pneumoniae subsp. ...
WP_013199988           78 RSGRKTVTLDAGLLARVMRTAEHALNAEDGAAWDAGAGTPPAVRDGLADIARVRALL 134 Erwinia billingiae
Q7ARC0                105 KEAVPAVMVPADLLETLLTTAEQALWHREWTARDSNHPVPESVTRRLADAAKVRALL 161 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap