Conserved Protein Domain Family
DUF1378

?
pfam07125: DUF1378 
Protein of unknown function (DUF1378)
This family consists of hypothetical bacterial and phage proteins of around 59 residues in length. Bacterial members of this family seem to be specific to Enterobacteria. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.
Statistics
?
PSSM-Id: 115758
View PSSM: pfam07125
Aligned: 3 rows
Threshold Bit Score: 111.543
Threshold Setting Gi: 446066932
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000144787  1 MTFVHTMLLYFCAVVSALYLVSGGYKVIRNYIRRKIDDAAAEKLSKTAQAPSSPNDPTP 59  Enterobacteriaceae
WP_000143462  1 MTFLNQLMLYFCTVVCVLYLLSGGYRAMRDVWRRQIDKRAAEKISASQSAGSKPEEPLI 59  Escherichia coli
KOZ64391      1 MRFVQLILLYFCTVVCTLYLVSGGYKVIRNYIRKKIDAAAAEKISASQSAGTKPEEPLI 59  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap