Conserved Protein Domain Family
DUF1373

?
pfam07117: DUF1373 
Protein of unknown function (DUF1373)
This family consists of several hypothetical proteins which seem to be specific to Oryzias latipes (Japanese ricefish). Members of this family are typically around 200 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399832
View PSSM: pfam07117
Aligned: 3 rows
Threshold Bit Score: 228.867
Threshold Setting Gi: 1357701558
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9W7C9         4 VLWICLLMIGSINCLPQG-GvpnMAVPRSMWLPPy---YGQEPSRPSYEEPSGQYGG---YPTFPGSYSPEPQTGGS--- 73  Japanese medaka
XP_024134339   3 VLWISCLLIGSITCYPQQgG---SGVPPSMWLPR----SGQAPSKPGYEEPSEQTGGhdsSSSFPWLYSSNTAGGPSdsg 75  Indian medaka
XP_024136794   3 FLWISCLLIGSISCLPQG-G-----------YTPmfqyPGQ---APSYEKPSAQSSG---YSSPQGYYSAGTNTAGGssd 64  Indian medaka
Q9W7C9        74 GSPPMWYSASYPEQEPAKPTYQRPA-QSSGHGSYGG---VDSSYSGSGSQHSGSQGAQSGApgsqhqVEQESWSSSSD-- 147 Japanese medaka
XP_024134339  76 IFQPMWYPAMPSEQEPSKPSHQKPTgQSSTYGSYSGpytAGGAYSSSGSQQYGAPSSQSGG------AEQESWSSSSDgd 149 Indian medaka
XP_024136794  65 STPPMWYTASYPEQEPAKPTYQRPA-QSSGQGSYSG---GDSSYSGSGSQQSGSQGAQSGApggqyqVEQESFSSSDD-- 138 Indian medaka
Q9W7C9       148 DEDEPEFTPVSEEDQVYAFKTRSRYNQKRLLFSQFRYTPTEPRVPQEPVFPYPSK-SHQGKSSAKGSR 214 Japanese medaka
XP_024134339 150 DEEEPVFTPVSEEDQVYAFKSRSRYNQKRLLFSQFRYTPTEPRQHQDPVFPHTGKtSQHGKGPVKGGY 217 Indian medaka
XP_024136794 139 DDEEPEFTPVSDEDQVYAFKSRSRYNQKRLLFSQFRYTPTEPRVPQEPVFPYPSKsSHQGKGSMKRGR 206 Indian medaka
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap