Conserved Protein Domain Family
DUF1367

?
pfam07105: DUF1367 
Protein of unknown function (DUF1367)
This family consists of several highly conserved, hypothetical phage proteins of around 200 residues in length. The function of this family is unknown. Some proteins are annotated as IrsA (intracellular response to stress).
Statistics
?
PSSM-Id: 369209
View PSSM: pfam07105
Aligned: 7 rows
Threshold Bit Score: 299.755
Threshold Setting Gi: 123563246
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012072960         13 HAVK-YANGAVVAETdydRNLLKS-LPVGSAVKiMPLSNN--RNYQHHKKFF-ALLDAGFEYWQPEFSVLTQAEEWIAQA 87  Actinoba...
Q32IS7                5 QLVKqTSSGLLLPAS---CDFLHQ-IKIGEWIH-ADFKRV--RNYAFHKRFF-KLLQLGFDYWTPVGGAITPRERKLVSG 76  Shigella...
WP_015958295          5 HLIK-QSQGLLIPATqetSEFLQSkCKLGAVLE-ADFKLV--RNPAFHRRYF-ALLNLGFEYWEPTGGAISSNERRLITG 79  Klebsiella
Q8ZQA6                6 QLIK-QSSGILIPATpetSEILQSkIKLGAVLV-AEFRQV--RNPAFHRRFF-ALLNLGFEYWEPTGGTISANERKLVNG 80  Salmonel...
Q7N1K4                5 SFIK-ISNDTLRPATpaaREYLHSkVKWGDVLY-ADFKKA--RNPRFHRKYF-ALLNLGYEYWEPAGGTISPEEKALVRG 79  Photorha...
Q4KA58                5 ALIR-TAQG-LVPATeadRETIQC-WKAGQVIH-GKFTKM--RNARFHGKFF-AMLDLAWEYWEPVGGLIPRQEMRGIRG 77  Pseudomo...
wkYale:SALWKB2_1876   4 VAVK-AVDNSLRPVTaidADSLKG-FKVGQPVK-IQVTRQkdRSLSHHRLFFgGLLPFAFDYWQPAGGVISPKERDVVLW 80  Snodgras...
WP_012072960         88 VAHEIAIVANDEhlyqNVTKPIADRVLAKVRSNReskldyEGMKTLEAYLDHVMKKAGFYDIKPSQDGGTTKERWSISFA 167 Actinoba...
Q32IS7               77 FVDYLCESVGREh--tPALSEAAEQYLNTVATRR------TRDTALLAFREWVTIQAGFYTEHIYPDGSRGGRAKSIAFA 148 Shigella...
WP_015958295         80 YAKFLAAYGGSE----SALLDAAGQYLDRIAEKRsg--yiSICKSFDAYRAWVIVEAGHYDAIQLPDGTLKKHPRSISFA 153 Klebsiella
Q8ZQA6               81 YAKFLAAYGGNE----SALLDAAEQYLEQIANRRvtn-giSLCKSFDAYRAWVTVEAGHYDAIQLPDGTLRKHPRSIAFS 155 Salmonel...
Q7N1K4               80 YVQFLAHFAGSE----DVLQSAADEYLAGISKNRaq--niTATKSFDAFRRWATVESGHYDIYEMPNGSLYREPRSVSFA 153 Photorha...
Q4KA58               78 LAKFFEAQNGRP----GQLSNAVDAYIAGLEQARaer-fpSVDKSREAFREWVTIEAGHFHLVRTPDG-VRKEAKSISWA 151 Pseudomo...
wkYale:SALWKB2_1876  81 IAKRLDKFAGNK----GIIVTAAEEALNLLAKKRaek-lpVIDKDIDSFRRWLTIEAGYFNICVTPAG-VVKEPKSISFA 154 Snodgras...
WP_012072960        168 NMSQEKFNSVYRAVFGVIWNETLCNIYESEWELDNKINQLIGF 210 Actinobacillus succinogenes
Q32IS7              149 NMDETEFQQVYKSVLNVLWNWSLFRKFSSPEEVENVAAQLLEF 191 Shigella dysenteriae Sd197
WP_015958295        154 SMDECEFQELYKASLDVLWRWILSRSFNSLQEAENAANQLLSF 196 Klebsiella
Q8ZQA6              156 SMDEVEFQQLYKSALDVLWRWILSRTFRTQREAENAAAQLMSF 198 Salmonella enterica subsp. enterica serovar T...
Q7N1K4              154 KMEEMEFQELYKDTLNVLWNFILYRNFPTRNAAEHAASQLSDF 196 Photorhabdus laumondii subsp. laumondii
Q4KA58              152 NMDDTQFEPLYRDVFNACWRLVLSAHFETEEAALAAADQIGSF 194 Pseudomonas protegens Pf-5
wkYale:SALWKB2_1876 155 SMDQDEFNAFYKACFNVCWNMILCNRFSSEDEAQQAIDQLLSl 197 Snodgrassella alvi wkB2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap