Conserved Protein Domain Family
DUF1363

?
pfam07101: DUF1363 
Protein of unknown function (DUF1363)
This family consists of several Trypanosoma brucei putative variant specific antigen proteins of around 80 residues in length.
Statistics
?
PSSM-Id: 115736
View PSSM: pfam07101
Aligned: 2 rows
Threshold Bit Score: 220.366
Threshold Setting Gi: 189094629
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAQ57283   1 MSRHGNIDIGCGAGNTMDATFRSCTPHESFYYLSINHDLKAREAQNNNTNSDTICFSTHLHKRSNRRLDRRCEYIFGICS 80  Trypanosoma brucei ...
CAQ57289   1 MSRHGNIDIGCGAGNTMDATFRSCTPHESFYYLSINHDLKAREAQNNNTNSDTICFSTHLHKRSNRRLDRRCEYIFGICS 80  Trypanosoma brucei ...
CAQ57283  81 IKGNSAARRKKFLNTPLCQRYLNNCLKYMHSICHYQTRPGRTSS 124 Trypanosoma brucei brucei
CAQ57289  81 IKGNSAARRKKFLKTPLCQRYVNNCLKYMHSICHYQTRPGRTSS 124 Trypanosoma brucei brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap