Conserved Protein Domain Family
IgaA

?
pfam07095: IgaA 
Intracellular growth attenuator protein IgaA
This family consists of several bacterial intracellular growth attenuator (IgaA) proteins. IgaA is involved in negative control of bacterial proliferation within fibroblasts. IgaA is homologous to the E. coli YrfF and P. mirabilis UmoB proteins. Whereas the biological function of YrfF is currently unknown, UmoB has been shown elsewhere to act as a positive regulator of FlhDC, the master regulator of flagella and swarming. FlhDC has been shown to repress cell division during P. mirabilis swarming, suggesting that UmoB could repress cell division via FlhDC. This biological function, if maintained in S. enterica, could sustain a putative negative control of cell division and growth exerted by IgaA in intracellular bacteria.
Statistics
?
PSSM-Id: 399824
View PSSM: pfam07095
Aligned: 14 rows
Threshold Bit Score: 1091.58
Threshold Setting Gi: 123518692
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014333533      3 LVLLCIAIIATASYFWLVLR-RRQRDESVVRFSTPSQRKLSQKERDAVERYLRQNEG----LGQTp--iTHRNNLIILRD 75  Rahnella aqu...
P58722            8 LALLLTSLIAVGLLWWLRFR-RPHPITAALPFVKLTHRKLTPEERVSIENYLRNQQNkhgfNTQPafdsHALAASTSSTP 86  Yersinia pestis
AHG19970          8 LALVLICLIAAGIYFWFVFR-EQSTLAYSLPFIKPTHRKLTTAERAAVESYLNQQNR----FSTR----LLPASPMLPSA 78  Chania multi...
WP_002444787      8 VATVLATVTLALSLLWRSQQ-QSARLP-AVNFPGATFRKLSADERKAAENYLETFNR----SRQL----VGLSAASNAPQ 77  Shimwellia b...
P45800            8 LAALLACSLLAGWLIKVRSR-RR-QLPWTNAFADAQTRKLTPEERSAVENYLESLTQ----VLQV----PGPTGASAAPI 77  Escherichia ...
wugsc:KPN_03769  10 LTALLICVLLIGWWYRAHAR-RR-RLPLLHAFSDATTRQLPADERQAIEKYVAELSH----AQQV----PA-SGATSAPV 78  Klebsiella p...
Q7NA48            8 LAILIISLIVMASFLIFKWK-LHDNDRYLPSVAAPTYRKLNADEYQAIECYLNRVLP------------PVVTNRINKTS 74  Photorhabdus...
WP_004249850      8 LAIFMISLFIMAAFLFFKRR-RLDGSYHLPSLAKPTYRKLTQDDYGVISDYLSYFGT------------SKFSSGYSLQN 74  Proteus
Q2NQI7            8 LAGVLACAIVSVIGWRFYRRrARPVSVKRLSFIKPFPRKLTAEERAAIEHYFHHSQP----LTRT----TPLSAPEPAAA 79  Sodalis glos...
WP_013319764      8 LAVLFACLIAVGGIIGYLMY-RRLLFAKRLPVTPSGHRQLTASERIAIERYLAMSHL----DG------PVSSSVSVASP 76  Dickeya dada...
WP_014333533     76 KLTLTTKSENVYSLTRAITRYGVASEDPNKWRYFLDSTEIHLPPFWEQYIAQENQVELIKTQTLPLVISLNGHTLTEHVY 155 Rahnella aqu...
P58722           87 MLVLTPQSDNVYSVTRAITRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNNHQS 166 Yersinia pestis
AHG19970         79 RLALTSQSDNVYPITRAITRYGLASDEPNNWRYYLDSEEVHLPPFWEQYISADNHVEVIKTQTLPLVISLNGHSLLDHIY 158 Chania multi...
WP_002444787     78 PLTLSPRSTKVICVTRAITRYGLSTDEANKWRYYLDSVEVHLPPFWEPYISNDNRIELVRTETMPLVISLNGHTLQDYVN 157 Shimwellia b...
P45800           78 SLALNAESNNVMMLTHAITRYGISTDDPNKWRYYLDSVEVHLPPFWEQYINDENTVELIHTDSLPLVISLNGHTLQEYMQ 157 Escherichia ...
wugsc:KPN_03769  79 ALALNEQSDTVYAVTRAITRYGITTDAPNKWRYFLDSVEVHLPPFWEQHINDENSVELIPTDSLPLVITLNGHSLSDYRQ 158 Klebsiella p...
Q7NA48           75 WPILMGKNDMVYTICHSITRFSVASDERHSWRYYIDMAEIHLPFFLEPFIKQQNIIDVIHTATIPLVISINGHFLKDFQQ 154 Photorhabdus...
WP_004249850     75 FPEIPTKGEVVTTLRNIVNRFAGSSEGLNHWRYYIDAVEIHIPPLLVPYLQQENVLDVVCTPSIPIVIGVNGHFLKDEKS 154 Proteus
Q2NQI7           80 SVPLTPRSDNVYAGTHAITRYGLATDAPHKWRYYLDSIEIHLPAQWEQYIAEENHVELIRTDSMPLVISLNGHSLLNDAP 159 Sodalis glos...
WP_013319764     77 RLPRLLPGNRVYPITHSITRYGLSTDAPNKWRYYIDTQEIHLPARWEQYITQNNEIELIKTRSIPLVVSLNGHSLTEFIN 156 Dickeya dada...
WP_014333533    156 EGP--------APVSAVMPsqPQNASIRHEESEHIELVKVRRETREEHALTRSNGVKEALAVSAILLVLFITLQSPVIFL 227 Rahnella aqu...
P58722          167 ENT--------YQPILPSV--SKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIALLLLFFALSGPTVTL 236 Yersinia pestis
AHG19970        159 DRP--------PTPVVTTTipEKNASIRQKESEHVELVNIRKETYQENSLNRPNGIKEATSISAALLLLFFSLISPIMVI 230 Chania multi...
WP_002444787    158 EAA--------GFALENTS--QGHSFIRGEESEQVELRHVRQETPEEYALSQAENLRDPLFIVAALVLAFLCLVTPGFLI 227 Shimwellia b...
P45800          158 ETR--------SYALQPVP--STQASIRGEESEQIELLNIRKETHEEYALSRPRGLREALLIVASFLMFFFCLITPDVFV 227 Escherichia ...
wugsc:KPN_03769 159 EAQ--------SYALERAS--ATQASIRGEESEQVELRQIRRETPEEHALNRPDGLREAILIVASFLFFYFSLIGPAVFT 228 Klebsiella p...
Q7NA48          155 DFPs-------APVIADIS--HQQASIQKNGETSVKLQNIRKETLEEYRLNHSSGIWEGGFLCFGFFIWFFALLSPALLL 225 Photorhabdus...
WP_004249850    155 HFSalslkqlsEPI---LS--NGTSTIQKNEGDAAHLLHIRQETNEEYRLHHSSGFWNGSLICLGLILWLTALMMPQVFL 229 Proteus
Q2NQI7          160 SAL--------TPAPAHAA--VPNSSMREQGNEQVELLKVRKETPQERAISQPSGQREAALCSAALLLILLSLLAPIMAQ 229 Sodalis glos...
WP_013319764    157 EMD--------SSAGVDIP--GEQASIRPEVHEHTELVAIRRETLEEHAVHRSRGLRETGVLSLAFLLLVFSLTSPLAML 226 Dickeya dada...
WP_014333533    228 PWLLLISAGLAAWVIWRLVSERLGKNRKEIHCLRGLPKRWGLFGESKQGDISNISLGAVDLIYPPHWQPYIGRDLGQPTD 307 Rahnella aqu...
P58722          237 PWLVIVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGESNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTH 316 Yersinia pestis
AHG19970        231 PWMIFVAVLMIVWGCWNLLRHPAESELKEVHCLRGTPKRWGLFGEPEQGQISNISLGMIDLTYPPHWQPYLTADLGKITN 310 Chania multi...
WP_002444787    228 PWLAGAGLILCAVGCLGMFAPPARRSLREIHCLRGTPKRWGLFGESDQDPLNNISLGVIDLIYPKHWKPFVSHNLGRQTD 307 Shimwellia b...
P45800          228 PWLAGGALLLLGAGLWGLFAPPAKSSLREIHCLRGTPRRWGLFGENDQEQINNISLGIIDLVYPAHWQPYIAQDLGQQTD 307 Escherichia ...
wugsc:KPN_03769 229 PWLVAAGLLLLAAGLWGIYAPPRRAALREIHCLRGVPKRWGLFGENDQEQINNISLGIIDLIYPRHWQPWIAQDLGQQTD 308 Klebsiella p...
Q7NA48          226 PWLMLIAGSLVVVSFWPLLCPLSICRRQDIHCFTGIPKRWGLFGEFEQGQMSNISLGGIDLIYPPHWEPYVAYYFDQKTS 305 Photorhabdus...
WP_004249850    230 PWIMAAGGTFLVLGLFLIYRPIIKSRKQEVQCFKGRLKRWGLFGNFDHGQVKNISLGGIDLVYPPHWEPYIQNDIDKVTY 309 Proteus
Q2NQI7          230 LWLAALAALPAALAAWLRFRPTPQRNRQDVNCLRGIPRRWGLFGESGQGSISNISLSSLDLKYPAHWQPYIARDLDKKTD 309 Sodalis glos...
WP_013319764    227 PWLAGAACLMAGWGCWQLFRPPSQKELREVHCLHGTPQCMGLFSDASQSQIGNVSLGNIDLIYPPHWQPYIGYDLGRKTD 306 Dickeya dada...
WP_014333533    308 VEVYMNSHVVRQGSYLTLHDEVKKFPLQLWGRNLVLATSAFLLLLALLVYVPLGLPLKLSVAWLQGAQSSQVNSVQELEK 387 Rahnella aqu...
P58722          317 IDIYLNRQVVRQGAFLSLHDEMKMFPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDK 396 Yersinia pestis
AHG19970        311 VDIYLNRQVVRQGHYLSLHDEVKHFPLQQWGKNAVLAASALVTILLLLTYVPLSLPVKLSSAWLQGAQKTEVTNVQALEA 390 Chania multi...
WP_002444787    308 IDVYLDRRVVRQGPFLSLEDEVKHFPLQRWSRSLVLATGSLLVLVMMAIWVPLDMPLKLTLSWLKGAQTISAQHVRQLES 387 Shimwellia b...
P45800          308 IDIYLDRHVVRQGRYLSLHDEVKNFPLQHWLRSTIIAAGSLLVLFMLLFWIPLDMPLKFTLSWMKGAQTIEATSVKQLAD 387 Escherichia ...
wugsc:KPN_03769 309 IDIYLNRHVARQGRYLSLHDEVKNFPLQYWLRSAIIAAGALVVVIMLWASVPLNMPFKFTLSWLKGAQTIEATTVSQLEK 388 Klebsiella p...
Q7NA48          306 IDIYTNGQVVRQGHYLSLHDEEKNYPYRRYGKNLMMIASCLLIMLLLYFYQPVSVPMKLSFAWLHGSSTKVITDANMMEG 385 Photorhabdus...
WP_004249850    310 LEMYPNHHVIKQGPYLSLHDEEKNYPYKRYIKNIIFVVCSLFIIGMLYLYQPLSLSMKLTFSWIKESEPHLVTNFTELET 389 Proteus
Q2NQI7          310 IDIYVNSQVVRQGRFLSLHDEVTYFPLQRWGGNLMMLCSSLLVLSLLLAYVPLSLPLKLSVTWLQGAQTVPVDSVATLNQ 389 Sodalis glos...
WP_013319764    307 VDIYLTRQVVRQGHYLSLHNEVKFFPLQQWGKNAVLAVGALLSLILLLTSVPLDLPLKLSLAWVQGTSSVKVTQVEDLER 386 Dickeya dada...
WP_014333533    388 AALRVGDTLKVQGTGMCYV--PP----AASRSA-SGFMPFDCSAIYWNTATPLPVPQSEIIDAATALQTTVNNQLHPGQN 460 Rahnella aqu...
P58722          397 MPLRIGDMLKAQGNGMCYV--PPn---IQNTRG-FVFTPFDCSGIYWNTASPLPQPESETIEKAAALVETINKQLHPQGS 470 Yersinia pestis
AHG19970        391 IPLHIGDTLKIQGYGMCYL--PPd---EGNSTT-AGFMPFDCSRIYWNNADPLPPPESEVIDKAAALLATVNKQLHPSGT 464 Chania multi...
WP_002444787    388 AGVKVGDTLKIQGTGTCNI---Gs---FSPRNH-SPFAPFDCSQIIWNTARALPFPESETVAKASALLASVNQQLHPQPG 460 Shimwellia b...
P45800          388 AGVRVGDTLRISGTGMCNIrtSGt---WSAKTN-SPFLPFDCSQIIWNDARSLPLPESELVNKATALTEAVNRQLHPKPE 463 Escherichia ...
wugsc:KPN_03769 389 AHVRIGDTLRLTGTGMCNIrtPGs---WSAKED-SPFLPFDCSQIVWNDAPPLPLPESDIVSKATALMQSVQRQLHPETD 464 Klebsiella p...
Q7NA48          386 MELRVGDILKAKGVGMCYM--PPn--nMNGKGD-TYFSPFDCSGIYWNRVNPLPIPESEIIENAAKLIATVNKQLRLQEN 460 Photorhabdus...
WP_004249850    390 AKLHVGDIIQAKGVGMCYM--PPn---LSSKNNkTIFAPFDCSGIYWNNSNPMPMPESSTIEKAAALLYLVEEQLHPVS- 463 Proteus
Q2NQI7          390 AMLRIGDTLSARGTGMCYV--------QSDGGR-TPFFPFDCSAIYWNNAVPLPMPESDTVDRAEALLTTVNNQLHPALD 460 Sodalis glos...
WP_013319764    387 MPLHIGDKLQVRGAGMCYV--PPinlnPTSSRA-SAFAPFDCAAIYWNKAAPLPLPESDTIEKTTALQKTVNEQLHPAAS 463 Dickeya dada...
WP_014333533    461 qmpEQNINPQLATAIEKSGMILLDDFADIVLKTETLCGNS-NDCVRLKNALVNLGNSSNWNSLVKRAKAGTLQGINVLLR 539 Rahnella aqu...
P58722          471 ---DASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSEN-TDCIRLKNALVNLGNAKNWSALVKRAQSGNLEGMNVLLR 546 Yersinia pestis
AHG19970        465 ---QQKLNPQLASAIEKSGMILLDDFSDIVLKTQELCSLE-SDCIRLKNALVNLGNAKNWASLVKRAKSGALQGVNVLLR 540 Chania multi...
WP_002444787    461 ---ESEVNPQLASAIQRSGMILLSDFADIVRKTQALCTGR-DECVRLKNALTNLGNTRDWATLTRRASTGKLDGTNLLLR 536 Shimwellia b...
P45800          464 d--ESRVSASLRSAIQKSGMVLLDDFGDIVLKTADLCSAK-DDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLR 540 Escherichia ...
wugsc:KPN_03769 465 d--DSRVSPALRSAIQKSGMVLLDDFGDIVQKTNDLCSAK-DDCLRLKNALVNLGNTRNWETLTKRATAGKLDGVNVLLR 541 Klebsiella p...
Q7NA48          461 ---NDVINPDLPQEIFKSGMILLDNFSDIVLKTKELCEKE-ADCLRLKNALVNLGSAIDWLTLLKNAESGKLDGTHVLLR 536 Photorhabdus...
WP_004249850    464 ---NNRVNPSLGQAITKSGMNLLDNFDGIILKTQDLCPRE-NECIRLKMALVNLSNVNDWPSLVQRAESGKLTGTNVLLR 539 Proteus
Q2NQI7          461 n--ENKITPGLASAIQKSGMILLDDFSDIVLKTQELCQDDaAPCQRLQAALVNLANGRDWPTIVKRARAGSLRGINVLLR 538 Sodalis glos...
WP_013319764    464 ---DNQVSSQLADAIQKSGMILLNNFSDIVLKTDALCEKE-EDCTRLKNALINLGNAKNWELLVKRARSGALKGMSVVLR 539 Dickeya dada...
WP_014333533    540 PVSAQSLSELVNNATSSFFVQETRRAADSLNSPPPGGFLISNDEGRQLIEMPAPPV------GVFANPPQEQWKQLQQLS 613 Rahnella aqu...
P58722          547 PISADVLENLINTAASSFVYRETHLATEALNSPPPGGFLITSDEGKQLVNHPAPTL------PLFDYSALEQWRELQRLS 620 Yersinia pestis
AHG19970        541 PVSAESLENLSNTAASSFVTEEIRQATATLNSPPPGGFLITSDEGKPLVDHPKPNS------PLNENNALEQWNELQRLT 614 Chania multi...
WP_002444787    537 PVSAESLDNLVTTSTNPFFLRETERAAQALNSPAPGGFVIISDEGNSLVNLPGPAT------PLDDYPPAERWSALRHLA 610 Shimwellia b...
P45800          541 PVSAESLDNLVATSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSA------SLYDYPPQEQWNAFQKLA 614 Escherichia ...
wugsc:KPN_03769 542 PVSAESLENLVTTSTAPFVIRETSRAAQALNSPAPGGFLIASDEGSVLVNQPWPAV------SLYDYPAHEQWGELRRLA 615 Klebsiella p...
Q7NA48          537 PAGAEALGKLVDATTSSFIYREIDKVAMLLNSPSPGGVLLISDEGKQLVEYITPAIisydhsVLEDHSALEQWRELQRLS 616 Photorhabdus...
WP_004249850    540 AVSAEALEKLVDTTTSSFIYREIDKAAILLNSPPPGGVLLISDERKQLVDYASNTN------SVFEPTPLEQWRELQRLS 613 Proteus
Q2NQI7          539 PVSADTLEALVNAATSYYFASETRNATNALNSPPPGGFLIRSDEDKQLVETPPPAI------NFNDYNGLAQWHELQRLS 612 Sodalis glos...
WP_013319764    540 PVSAESLDSLVKNATDEFYSREIITASNSLNSPPPGGFLIRSDEGRQFVNHQMPTT------PLRDFPPQEQWQELQRLS 613 Dickeya dada...
WP_014333533    614 TLLLHTPFSAQGVITSISIDANGTRHISLHSEPDISTLWRYLGTSLLLLLLIGVLAVNTVLFIRRFIKDKRRIDDIQQYY 693 Rahnella aqu...
P58722          621 ALLLDTPFKAEGIITNITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMDNIQRYY 700 Yersinia pestis
AHG19970        615 NLLLRAPFQAQGVITNISVDANGTRHIALHSEPDMITLWRYLGTSLLLLALVASLGYNAWRLLQRWRKNQHRLADIQRYY 694 Chania multi...
WP_002444787    611 GQLMNTPFTAEGIVTGIQTDANGTRHVTLHAIPDSAGIWRNTGTTLLLLLLLGCTLWNGVMAVRRYQHNQMRTVAIQRYY 690 Shimwellia b...
P45800          615 QMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIPDRSGLWRYLSTTLLLLTMLGSAIYNGVQAWRRYQRHRTRMMEIQAYY 694 Escherichia ...
wugsc:KPN_03769 616 GMLMHTPFHAEGIVTNLFTDANGTQHINLHRIPDRSGLWRYLGITLLLLSMVGCMAYHAVQALRRYQRHRQRMEEIQKYY 695 Klebsiella p...
Q7NA48          617 DMVLQTPFETTGIVTELSVDSHGTRRIVLHSELDAMTLARCIGTTILFLALFTTLIINFVLVVKKNRQNKQRLNKIKQYY 696 Photorhabdus...
WP_004249850    614 DILLHTPFNTGGVITGMVIDANGTLQIFLHSMPDSMTLLYYIGNTLLLFFAIGFLILNLFFIIRRRRQNNQRMHKISQYY 693 Proteus
Q2NQI7          613 TQLLHTPFNAEGIITNITVDANGTRHIALHNEPERVSLWRNVGATLLLILLLTLAAFNAILLVRRLHNGRRRARDIQRYY 692 Sodalis glos...
WP_013319764    614 SMLLHTPFEANGVITQLSIDANGTRHISLHSEPDAVTMWRSLGACLLLLAFSVILILNLVLLLVKRRRSQQRIANIQQYY 693 Dickeya dada...
WP_014333533    694 NSCFHPTLM-PM 704 Rahnella aquatilis
P58722          701 DDCFNQTLT-PP 711 Yersinia pestis
AHG19970        695 DSCFNPQLT-SA 705 Chania multitudinisentens RB-25
WP_002444787    691 EDCLPKNLL-Pg 701 Shimwellia blattae
P45800          695 ESCLNPQLItPS 706 Escherichia coli K-12
wugsc:KPN_03769 696 ESCLNPVLL-PS 706 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Q7NA48          697 DNCFNTLFP-PT 707 Photorhabdus laumondii subsp. laumondii
WP_004249850    694 EHCFyrppq--- 702 Proteus
Q2NQI7          693 DCCFSHEAI-AA 703 Sodalis glossinidius str. 'morsitans'
WP_013319764    694 ARHLVPEtpvat 705 Dickeya dadantii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap