Conserved Protein Domain Family
SGT1

?
pfam07093: SGT1 
SGT1 protein
This family consists of several eukaryotic SGT1 proteins. Human SGT1 or hSGT1 is known to suppress GCR2 and is highly expressed in the muscle and heart. The function of this family is unknown although it has been speculated that SGT1 may be functionally analogous to the Gcr2p protein of Saccharomyces cerevisiae which is known to be a regulatory factor of glycolytic gene expression.
Statistics
?
PSSM-Id: 399823
View PSSM: pfam07093
Aligned: 31 rows
Threshold Bit Score: 722.499
Threshold Setting Gi: 118343832
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDV96819      18 VEYYIFPK--LSDGGDEEQVRQQLELVRVECLAIVEKKISDrcYIWHKDEFQLLTRTGSaeecllneednnkqeeeetet 95  Drosophila grim...
XP_967648     17 VEYHLFPP---IDSQDDKEQELALTRVLNQCEKIVKRYTDE--YLWHKDEFKLTVRTWIsnslih-----------dsek 80  red flour beetle
Q2LYT2        27 VEYFIFPKl-PDNLTDEFQVKEKLLRIKTEIMEIVRELVVQrsYIWHKDEFQLQVRTGStlerllnde----tnvaedde 101 Drosophila pseu...
XP_001955876  18 VEYYIFPRl-PDNLREPTKLHQQMVEVHKDINAIVKEKTLErsYLWHKDEFKLQIRTGSpeerllnee----tnpeeetn 92  Drosophila anan...
4_pfamImport   1 VEYFIFSD------HDKDNPLEFYGRLGQQVENAVKESSKD--YIWQKDEFHVISRNVNdlppi-------------idn 59 
XP_001947588  16 VEYFLFVRs-DDSEEDAEELVKHINNLNTKALELVDRLSEQ--YIWHKDKFNLIPRFCPsaelrqs---------fsdts 83  pea aphid
Q949K3        23 VFFSIYPDftLNPTSPPTSITSQLQSLHLQILQNLSPFTSN--YIWQHEPFTLTLSP----------------------- 77  tomato
KRH39459      19 VFYAIYPD------SPTTTSTATLRSLHLKILETLSPFTED--YIWQHQPFTLSVSTPPnpscp-------------cps 77  soybean
XP_006381540  19 VYYAIFPD--SSSLSNPSASSQSLH-LYLQILDFISPYTSS--YIWQHEPFSLSLSSSS--------------------- 72  black cottonwood
Q9LSM5        22 VFFSLFPD--------SSLSSAALQSLHLEIIDFVSPFTSP--YIWQHEPFSLSIALSSsca-----------------c 74  thale cress
EDV96819      96 yGALPPHLHGVTHYGDNIGDEWFIVYLLGELTRSRPDCIVRVSDADGEFLLIEAADVLPDWASPETCEQRVYIVNGGLQL 175 Drosophila grim...
XP_967648     81 tEYLPPHLYGVTHFGDNIEDEWFIVFLLRLLTKEIDGLIARVHDADGEFILIEAADYLPLWADPNNCENRVYIYQGNIHI 160 red flour beetle
Q2LYT2       102 dGDLPPHLHGVTHYGDNIGDEWFIVYLLLEISQARGEYIARVCDSDGEFVLIEAADVLPDWASPDTCEQRAYIVNGALQL 181 Drosophila pseu...
XP_001955876  93 mGDLPPHFHGVTHYGDNIADEWFVVYLLTEITRARGDCIARVCDSDGEFLLIEAAEALPDWASPESCERRVYIVNGGLQL 172 Drosophila anan...
4_pfamImport  60 eERLPPHLYGVTHYGENIEDEWFIVYLLIQLTKNIPGLIARVVDTDGEFLLIEAADFLPKWASPEVCEKRVYIFDGEVHI 139
XP_001947588  84 dEVLPPHLYGVTHYGDNIEDEWFIVFLMKEITKEYPELVARVIDSDGEFLLIEAAECLPNWANPDNCDQRVYISDGDVHI 163 pea aphid
Q949K3        78 -GPTPPHLSGKLRYGDNLEDEWFVVFLLFETSKRFPSVSIRVWDSDGEFLLIETAFYLPRWVNPDTAMNRVFIRGGFLHI 156 tomato
KRH39459      78 sSSHLLHLHGRLRFGDNLDDEWFAVFLLFRISQRFPSLSIRIWDSDGDFLLIEAAFHLPRWLNPDTAHHRLFLRNGSLHI 157 soybean
XP_006381540  73 -SPPLPHLHGKLRFGDNIEDEWFTVFLLFQISHHFPSLSIRVWDNDGEFLLIEAAFHLPRWINPETSDNRVFIRRGDIHI 151 black cottonwood
Q9LSM5        75 tNTAIPHLHGKLKYGDNLEDEWFAVFLLFRISAAFPSNSIRVWDTDGEFLLIEAAFHLPRWLNPETSLNRVFIRGGDLHI 154 thale cress
EDV96819     176 VQNSATTSESESKRMPISSAVQRIRLNPTLFRCSRDIQNCIDSRLQEFlAAKPHASIHRQIVQLPQNAAQLLKQRPGLVA 255 Drosophila grim...
XP_967648    161 IPLDTSDHLPEMAQMAVNEAVSTIQNNPIDTLASSDIQNCIINKLKDY-PDKIQSSLHHATAYLPVGVAAILRHKPGLIA 239 red flour beetle
Q2LYT2       182 LQNSASTNP--DKPMPVPIALQRIRLNPNLYRCSTDVQNVLKTRLKEFlIAMPHYSIHRQIVEVPHSAAQLLKTRPQLVA 259 Drosophila pseu...
XP_001955876 173 LQNSAATSQ--DAVISMANALQRIRLNPTLYRCSREIQSCIDTRLKEFqIAQPHFSIHRQVVELPQSAAQLLKQQPGLVS 250 Drosophila anan...
4_pfamImport 140 IPKEKEKEI-----IFVGEALHKIRYNPQVTRAPDQIQGAITSRVQGY-PDKIQELLHQTNAYVPAAVAALLKERPSLIA 213
XP_001947588 164 IPLVSANSK---KSITVSQALEQITKYPTATIATQEVNSAISSRLHGY-PDKIKENLHCCHAYIPVGVAYLLKHQPSLIA 239 pea aphid
Q949K3       157 IPNSVIPTT-----PSIHEALNLLRNVSS-TRAPEGVQRQLENRLKEY-PNRAEKNVHKVRVRVPLSVAKVLKHEPCLIS 229 tomato
KRH39459     158 VPRNRLTN------PSLIDSLNFVASSPHESLASDAIQRAIKKRISNY-PEQARNNMHRVRVRVPVSAASILKHEPRLIS 230 soybean
XP_006381540 152 VPKSRLPN------PKLIDSLKFLIDCEGESRAAESVQIAVKGRISDY-PERARRNMHQARVRVPVSVAQVLKQEPCLIS 224 black cottonwood
Q9LSM5       155 VPRSRLPD------PSLVASLRFLIERGNESRASDSVQSALKNRISDY-PERAWRNMHRVRVRVPVSVAQVIRHEPFLIS 227 thale cress
EDV96819     256 SAVRAFCDRDSLDTKALRTMRYFPP-----ESpRKRTNVAFTRCLYAMLMHNQYTPERRLGWQ-LTDAvAQPEaHKEQLL 329 Drosophila grim...
XP_967648    240 PAVQVFCNRDPVDAKTCKAMKYFPP-----EN-RVNARVTFTKCLYAMLTHSKYVPDRRTGWN-LPKS-DSPQ-FKAQNL 310 red flour beetle
Q2LYT2       260 SAVRAFCDRDTEDIKALRTMKFFPP-----EAsRVRTNVRFTRCLYAMVMHNQYTPERRLGWK-IADEvSQPElHKEQIL 333 Drosophila pseu...
XP_001955876 251 SAVRAFCDRDSLDTKALRTMRFFPP-----EApRLRTNVGFTRCLYAMLMHQQYTPEKRLGWN-LTDSiAYPElYKEQLL 324 Drosophila anan...
4_pfamImport 214 PAVSAFCHRDPVDMRACRAMRFFPP-----ET-RVMCQVKMSRCLYAMLLHHKYTPDRRTGWC-LPQQ-NSPD-YLAHSI 284
XP_001947588 240 PAVIAFCHRDMLDVKACQTMKHFPP-----KE-RVMRTVTMTKCLYAMLIKQKCVPEKRTGWD-LVET-TDSR-YKAQIT 310 pea aphid
Q949K3       230 LAVEGFYDRDIDTMKFAAEMERFLGnggsgEE-LVRVLVTMSRAMYAQLVQQTFQAPKC--YPaLPPR-SDVGaYMEAEL 305 tomato
KRH39459     231 LAVEGFYDRDIDTMKFAARMERFVErg-ktEE-LVCVSVKMSRAMYAQLAQQRFQAPKC--YPeMPAR-SEREgFAEAEL 305 soybean
XP_006381540 225 LAVEGFYDRDIDTMKYAAKMEKFLSkg-keEE-LVCVVIKMSRAMYAQLMQQKFQAPKC--YR-MPNRgDDLGaYLEAEL 299 black cottonwood
Q9LSM5       228 LAVEGFYDRDMDSMKHAAKMEKFLSkg-reEK-LVLVLVKMSRAMYGQLVQQKFQAPNC--YP-MPSV-SDRDaFSEAEL 301 thale cress
EDV96819     330 GVKLASGLEILASQAKra----gDEADEKSTAwRAYLRSLQSKGYFRDNVEGSAEYVRLLATAKEYFKSNQTr---FRTA 402 Drosophila grim...
XP_967648    311 GVKIACGFEILAAQAKps------qDIEQDKGwVNYFEKLKEKNYFRGLLEHSREYNDLLNKAKEYYINHRDs---MHYS 381 red flour beetle
Q2LYT2       334 GVKLACGLEILATQAQra----gDCALEDQPAwRAYLRSLEGKGYFRDNIEGSAEHTRLLGKAQEYFKGNQDr---FRTA 406 Drosophila pseu...
XP_001955876 325 GVKLASGLEILASQAKrv----dGQKLEEMPAwRAYLRSLQSKGYFKDNLEGSAEYQQLLSKAMDYFRGNQEr---FRTT 397 Drosophila anan...
4_pfamImport 285 GIKLACGFEILVSQCKvk----dGDDLENDKGwLRYKQSLQDKGYFNELLEGSVGYTRLETEAKEYYRAHA-----MYSQ 355
XP_001947588 311 GIRIACGFEILVSQAKttvkddtPVDLTYDKRwHHYKSSLAEKGYFKNLYEGSNGYKLLEDQAKQYYLSNVDe---YLSS 387 pea aphid
Q949K3       306 GMKIACGFEMIYQLKKr------QGMDGKGSTwDAFRLSLERSGYFEGLLPGSKEYKRLMKNAEEYYKNSSLhareSATL 379 tomato
KRH39459     306 GMKIACGLEMMYQQRKr------DGEEGKGSSwEAFRKSLENSGYFQGQLPGSSEYQRLMQSAQEYYRSTSLhskaSDLL 379 soybean
XP_006381540 300 GMKIACGFEMMYQQRRr------EGEEGKGSTwLKYKESLERSGYFEGFLPGSKDYKRLMENAEGYYRNSTLfsrtSQMM 373 black cottonwood
Q9LSM5       302 GMKIACGMEMMYQQRKk------EGEDGKGISwSKYKDNLEKYGYFEGLLSGSKEYKRLMENAEEYHQKSSSfsrtRDIM 375 thale cress
EDV96819     403 PLVGAEIVDLLLHtGEsSAAEQLRDEENNLLPSDADDWLNISAEDLDAMLQQRYGPQKLY-------------------- 462 Drosophila grim...
XP_967648    382 PAIGQEIVQLI-KnLD-FKIDELKEESN--LPDDDDSWLNVSPEELDKMLEEKYGQKKFV-------------------- 437 red flour beetle
Q2LYT2       407 KRVGAEVLALMLHpSD-TASVALRDEQNNLLPSDKDDWLSITAHDLDALLQDRYGPNKLY-------------------- 465 Drosophila pseu...
XP_001955876 398 PRVGAEILELLLHpAE-AASEELRDEENNLQPSDSDDWLNISAEDLDSMLQDRYGPHKLY-------------------- 456 Drosophila anan...
4_pfamImport 356 SPIGKTVLDML-NnLE-VDVEGMKRAENSLPPPDDDSWMEISSEDLDKILSERYG------------------------- 408
XP_001947588 388 PSISQRIKNILDSvTE-QELVQLKSDISDLEPADDETWLDVSPSDLDRILEQKFGLKNSE-------------------- 446 pea aphid
Q949K3       380 SAPVRRIDEILa--LP-DSADDFKDQE--IPPSDDDSWLYGGEDELNSVLQERQKEMELYnskrkqks------keqdgp 448 tomato
KRH39459     380 NAPVRRIDEILa--LP-HSVDDFKDQE--VPPSDDDSWLYGGEEELNSVLMERQKEMELYdlkhkkkgkakegqdagpss 454 soybean
XP_006381540 374 SAPVKRIDEILa--LP-HSADDFSCQE--VPPSDDDSWLYSGEDELNAALQQRQNEMDLYnakhkkkqmpkesqdagpss 448 black cottonwood
Q9LSM5       376 SAPVRRIDEILa--LP-YSEDDFKGQE--VPASDNDSWLYDGEDELNSVLQERQKEMEFYnskkerknkgkekqeagsss 450 thale cress
EDV96819     463 -NPNGDMNAAEFTKHLSQFLDQQSNFEGIEMpgeagnde---------------ldsdddePPpppksksassassshaa 526 Drosophila grim...
XP_967648    438 -TVNNNSDAASFTEKISSFLNHVSDIDGVEH------------------------------PDldnsptrpprgvkkrtk 486 red flour beetle
Q2LYT2       466 -KPNGDMDAEEFTKQLSDFLDQQSNFEGIEHagceapd----------------ldsdddePAlrqpkastsqg-----s 523 Drosophila pseu...
XP_001955876 457 -KPNGDMNAEEFTKQLSDFLDRQSNFEGIEHqgheld-------------------sdddePEprkpddstssg-----a 511 Drosophila anan...
4_pfamImport 409 -SNRPNTSVNDISTHLTSFLEHVSGLEGAEH------------------------------PLvnkdgvplrpkr---gv 454
XP_001947588 447 -QSSASNFASSFTDKIRSFLNQASDINGADFsknhlsddsddsddedkpdddklsnllvcgPDvmlptnddkda-----v 520 pea aphid
Q949K3       449 sNHSDNFDLKDISNSMQAFVTKVASYEGAEV------------------------------PE----------------- 481 tomato
KRH39459     455 aSNADEFDPSDIAKTMQAFVHKLSSYKGAEA------------------------------PE----------------- 487 soybean
XP_006381540 449 sSNFDDFDLGEMAKAMQAFVDKASSYKGAEV------------------------------PE----------------- 481 black cottonwood
Q9LSM5       451 dANMNNFDLGDISKSMQQFMHKVSSYKGAEV------------------------------PE----------------- 483 thale cress
EDV96819     527 kvkksasmrkACQRNSLIQSDEQDSTHVRNFLDFVIPEDnw-------dSNSDMSDYADEDDLQRNfdalssasasGGDD 599 Drosophila grim...
XP_967648    487 vsfasgtkteTTANNRVSFDPNAFSCAVQNILNFVIPEDdsw----dldSGSDMSDYADDVAG-------------NEEM 549 red flour beetle
Q2LYT2       524 qlrknqsmrkACNRNSLIQSEEADSTHVRNFLDFVIPEDnw-------dSNSEMSDYADDDDIERNfda-----lsSSST 591 Drosophila pseu...
XP_001955876 512 kvkknpsmrkACQRNSLIQQEEPDSTHVRNFLDFVIPEDnw-------dSNSEMSDYADEDDLESNldrs--lsgsGAGN 582 Drosophila anan...
4_pfamImport 455 kknksqdqtrDDDNNRISFDQEAFTCAVQNILDFAVPEDswd----lesEESGMSSYEDEVEMDLSrkkt---dkrRESE 527
XP_001947588 521 avrynkkknkINEKSNVNFEPEKYEAALRSILDFKIPEDnwd-----esNSSDMDSYGSDCD--------------DIMS 581 pea aphid
Q949K3       482 ----------DRNVKEVDFDVDHFMKDLESFMRGQGNEDigrdv-dieeGSSSDMEFDESEDESDIae-------pHDDN 543 tomato
KRH39459     488 ----------DRN-KEVNLDVDQFIKDMESIMMHSDGEVansn---ieeGSSSDLDFDNS-DDSDIve-------lDEDN 545 soybean
XP_006381540 482 ----------NRNMKEVDLDVECFLNDMESVMKRYGPKDgaadv-dseeASSSDMDFDESEDESDIme-------aSEDN 543 black cottonwood
Q9LSM5       484 ----------NRDFKEVSIDVDRFMKDIESMLGSQGRDEqadddsdgseGSSMDMDFDDVEDDSe----------gEESN 543 thale cress
EDV96819     600 NYRLDRNIKAYMEQMDRELAQTTVGKSFHGKS-GTSNNTSPHHAAEDD----------FDDIEDFEPININ 659 Drosophila grimshawi
XP_967648    550 YEGVKNKMQEYMEQMDKELAATTIGESFEKKN-GDG----------------------FEDIESFKPVDID 597 red flour beetle
Q2LYT2       592 GFPLDRSIQAYMKKMDRELSQTTIGKSFQGKK-AAT------QADEDD----------FDDIEDFEPININ 645 Drosophila pseudoobscura
XP_001955876 583 VFPLDRQIKSYMEQMDRELAQTTVGKTFNGKK-KSA------QAEEDD----------FDDIEDFEPININ 636 Drosophila ananassae
4_pfamImport 528 DSQGKSELKQYMDQMDRELSKTTMGQSFHKKP-AKGMEDS------------------FSDIESFEPVDID 579
XP_001947588 582 GSQAGASISSYMAQMDKELASTSLGSSFVKKPtSDKNKLQKTVRIDPTvqcqdseednFSDVEDFEPVDID 652 pea aphid
Q949K3       544 DEGGAAFMHSYSDTLNDELKGTTLSNTFVRAN-GESESIKKDEGTSTAae------nmE--EEDFSPVDVD 605 tomato
KRH39459     546 EDREDIFMRSYSDAMNEELKATTLQKSFVRAN-EQIP--KKDQGTSNAse------hiM--DEDFSPVDVD 605 soybean
XP_006381540 544 VDGEDTFMNTYSDALNEELKNTTLKKSFVRTD-DQLS--KKNEETSNTme---------gmDEEFTPVDVD 602 black cottonwood
Q9LSM5       544 EDAKESFEESYYGAMNEELKNSTLEKSFENVN-QQHSS-KQNEESSKTrd---------ekDDEFTPVDAD 603 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap