Conserved Protein Domain Family
Jagunal

?
pfam07086: Jagunal 
Jagunal, ER re-organisation during oogenesis
Jagunal is an endoplasmic-reticulum (ER)-membrane protein found in eukaryotes. It is involved in reorganising the ER in cells that must increase exocytic membrane traffic during development, that is, in the oocyte during vitellogenesis. It facilitates vesicular traffic in the subcortex.
Statistics
?
PSSM-Id: 399819
View PSSM: pfam07086
Aligned: 31 rows
Threshold Bit Score: 168.586
Threshold Setting Gi: 390353600
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004923278  10 TGTNGADFEHREKVAIQYHISALNKSRLKYCVFFHHILFLGMMAKLSADVLDKLDIFileVEELQIPP-------PLWWE 82  domestic silkworm
XP_002127629  10 AGSDGSDHSFREKVASQYKTSASLKSTIKTLFLLSFLPMLVVLIHIMQEDLEIR------FLNVDLPQ-------VEVWQ 76  vase tunicate
EDV24985      11 KGSDGSDWKHRERVADHYKRSVEYKSSYSFFTDIYMILLVGVI-----------------VVEYILPYaltqsinASLWQ 73  Trichoplax adha...
XP_003728147  10 AGTDGSDFQHREQVASQYKTSVQLKSKFRTCLYINILVVLIQVVMFAGAHFHI------------IPSdf----yPSPWQ 73  purple sea urchin
EDO32175      10 SGTDGSDFSHRERVASHYRESVRQKAKMKFCILIHMFFGVCVVGWMGLAISRAVKIA------------------PDPWI 71  starlet sea ane...
AFI34517      10 AGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRL-------LSHDQVAM-------PYQWE 75  Rhesus monkey
EGW06202      10 AGTDGSDFQHRERVAMHYQMSVTLKSEIKKLIYVHLVIWLLLVAKMCVGHLRL-------LSHDQVAM-------PYQWE 75  Chinese hamster
XP_005807878  10 SGTDGSDFQHRERVASHYQMSVALKSEIRKLNIVHVLIWVLMAAQVTVSQLSL-------VSHKVVAS-------PYQWE 75  southern platyfish
Q5XJX0        10 AGTDGGDFKHREKVASHYQMSASSKSEIKKLTVVHFLIWILVAAQVAVSHLNL-------VSHDLVAM-------PYQWE 75  zebrafish
XP_003961803  10 AGPNGS-VKHRERVAPNYQMSSSLKSEVRKLNLVHLLIWLLVAAQVTVSHLNL-------VSHDTVSM-------PYQWE 74  torafugu
XP_004923278  83 YIWCLSLLLSFLGLSAIKRNNIRHLRQYVYGIVALGFCPLLYCVLYYCGDVWRYLSHDDEDDssevdIELWQGYPYGLLW 162 domestic silkworm
XP_002127629  77 YVYMLAPFITFIGYSSLHKNKATQMSIYIYFSLATLVPALLY---------KAWLNFTNPSQ------TTLFKMPLSVLN 141 vase tunicate
EDV24985      74 HIWLLSIVPVLIGRLALSRNNSGLMILFIFGTLCLGLGPLIAGARDYGFLMYRRINDRTPSDvkvatFAVFGTYSI-ILR 152 Trichoplax adha...
XP_003728147  74 YTWMLSGVVSLIGLNALAKNKKEMLSLHDLGLTIFGFGGIFFGFTSQYSSHQRYIASGETKR--------IADIPLHYIW 145 purple sea urchin
EDO32175      72 LLWLISVFPAIAGLSGLPKNQTKMMHVYSIGTMVTGIAPLMYGATFGIMQVMENFKRGHAPG-----TDDWRVLPMKMAM 146 starlet sea ane...
AFI34517      76 YPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYR-------FLFGFSAVSVM 148 Rhesus monkey
EGW06202      76 YPYLLSIVPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYR-------FLFGFSAVSVM 148 Chinese hamster
XP_005807878  76 YPYLLSIVPTVFSFLALPRNNISYLVVSMISAGLFCVAPLIYGGMEMFPVAQQLYRHGKAYR-------FIFGFSAVSVM 148 southern platyfish
Q5XJX0        76 YPYLLSLVPSFIGALAMPKNNISYLVISMISAGLFSVAPLIFGAMEMFPLAQQLYRHGKAYR-------FIFGFSAVSVM 148 zebrafish
XP_003961803  75 YPYLLSLIPLLCSSLSLPKNNISYLVLSMISGGLFSVAPLIYGSMEMFPVAQQLYRHGKAYR-------FIFGFSAVTVM 147 torafugu
XP_004923278 163 YAFVLLASQVHFFQLY-FSFNLLKAWRARG 191 domestic silkworm
XP_002127629 142 YIFVVLTILMHAYSLF-CASKLVKAWKQKG 170 vase tunicate
EDV24985     153 CSFIVIAFIVHILSLR-TGAKLCGVWRTKk 181 Trichoplax adhaerens
XP_003728147 146 -VFVLASNAINYLATYvYSIRLKAAWNvrk 174 purple sea urchin
EDO32175     147 VAFV---IQAHAVSIY-YSNKLISAWNTKG 172 starlet sea anemone
AFI34517     149 YLVLVLAVQVHAWQLY-YSKKLLDSWFTST 177 Rhesus monkey
EGW06202     149 YLVLILAVQVHAWQLY-YSKKLLDSWFTST 177 Chinese hamster
XP_005807878 149 YLVIVIAVQVHAWQIY-YSKQLLDQWFTAT 177 southern platyfish
Q5XJX0       149 YLLMVIAIQVHAWQIY-YSKKLLDAWFNST 177 zebrafish
XP_003961803 148 YVVMVIAVQVHAWQLY-YMKKLLDSWFNTT 176 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap