3NZR,3MUX


Conserved Protein Domain Family
KDGP_aldolase

?
pfam07071: KDGP_aldolase 
Click on image for an interactive view with Cn3D
KDGP aldolase
DgaF is part of the dga operon required for wild-type growth of Salmonella Typhimurium with D-glucosaminate. It catalyzes the conversion of keto-3-deoxygluconate 6-phosphate (KDGP) to yield pyruvate and glyceraldehyde-3-phosphate. Orthologues of the dga genes are largely restricted to certain enteric bacteria and a few species in the phylum Firmicutes.
Statistics
?
PSSM-Id: 399806
View PSSM: pfam07071
Aligned: 9 rows
Threshold Bit Score: 300.893
Threshold Setting Gi: 81507639
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NZR_D        10 YKNRVCLNVLAGSVDNAADIYDAAEGHVLVGVLSKNYPDVDTAVEDXKKYSEVTNnAVSVGL-GAGDPNQSXXVSLISQH 88  Aliivibrio fisc...
Q8ZL28         7 YRQRVAINVLAKDIANAKAIYEAAEGHAVIGVLSAQFATVEEGVPEVKRWMAEVP-SISVGL-GAGDPAQYYKAAMIAAH 84  Salmonella ente...
Q181P3         8 YKNRVCLNVLAGSIKNAKEVYDACDGHVLIGVLSKNYSTVEAAIEDMKKYSKEIDnAISVGL-GAGDPNQSNMVSQISKE 86  Clostridioides ...
Q837J8         8 LEERICLNVLANSVENAQACYEAAEGHVVLGVLSKNYETDEAAIDDMKKYQAATNnALSVGL-GAGDPNQSQMVARLSEV 86  Enterococcus fa...
3MUX_A         9 YKGRVALNVLANNIENAKDIFEAAEGYVVVGVLSKDYPTVEEAVTAXKAYGKEIDdAVSIGL-GAGDNRQAAVVAEIAKH 87  Bacillus anthra...
Q8ELL9         6 YNDRICLNVLASDITNAKEIYEATDGHVLIGLLSSNYTSVQEALEDIRVYDKVLDgSISLGL-GGGNPEQWKMVADISRE 84  Oceanobacillus ...
Q8Y429        12 WNNFALFNFLAKDKENSLEVMVAARGFAVPGIVATNYETAEEAANVVKELQTTAE-VISVGLgGGGDWQNWRDVLHIARL 90  Listeria monocy...
Q5WI55         1 MNEKVIFNVLAKDVENAKELVQVAGDRVLIGVMVKHFPSAKEAIDKVALYKNN-DiPVSVGL-GAGDPAMWKMVADVSAK 78  Bacillus clausi...
WP_011707609   8 YRARVCLNVLAGSRQNAVDIYEAAEGHVLVGVLSKNYPDVPSAVADMQAYAQLIDnALSIGL-GAGDPRQSAMVAELARQ 86  Aeromonas hydro...
3NZR_D        89 VQPQHINQVFTGVATSRALA---GQDKSIVNGLISPTGTVGXVKISTGPLSSR-SEDAIVPVETAIAXLKDXGGSSVKYF 164 Aliivibrio fisc...
Q8ZL28        85 THPAHVNQTFTGSGFAAGALaatGGEQTHINALVSPTGTPGEVVISTGVSSSQ-GTPARVSCEAAVRMMQDMGAHAAKFF 163 Salmonella ente...
Q181P3        87 LQPQHINQVFTGVATSRALL---GQNYSIINGLVSPTGKPGFVKISTGPLSSK-EKDGIVPIETAIAMMKDMGGSSIKFF 162 Clostridioides ...
Q837J8        87 LQPQHVNQVFTGVGASRALL---RQDETVINGLVSPTGKVGYVNIATGPLSSG-APAAEVPIETAIKLLKDMGGSSIKYF 162 Enterococcus fa...
3MUX_A        88 YSGSHINQVFPSVGATRANL---GGKDSWINSLVSPTGKVGYVNISTGPISAAgEEKAIVPIKTAIALVRDXGGNSLKYF 164 Bacillus anthra...
Q8ELL9        85 YKPRHINQVFPKVGYTRAAV---NHAQTMINSLVKPTGQPGLVDIATGPTN---KSLIIVEVEAAIQLTKEMGGNSLKFF 158 Oceanobacillus ...
Q8Y429        91 APNSHINQPIETAGLTNGLL-----PETYTNALVRPTGKVGIVKLSSGDE---------ITAEEAVDYCLSANIPSIKFM 156 Listeria monocy...
Q5WI55        79 TVPNHINQVFPAAGYTRGRMselKASTTLVNALIEPTGTAGEVYISTGPRSADfKEK--VSCELAAAMLAEIGVDSVKFY 156 Bacillus clausi...
WP_011707609  87 LQPQHVNQVFTGVGASRALL---GQPDTLVNGLVSPTGTPGMVKISTGPLSSQ-QPDGIVPIDTAIALLRDMGGSSVKFF 162 Aeromonas hydro...
3NZR_D       165 PXGGLETREEFACVAKACADKDFWL-EPTGGIDLENYEEIXQIALDAGVSKIIPHIYSSIIDK 226 Aliivibrio fischeri ES114
Q8ZL28       164 PMGGEKSLPELYALATTAARHGMTLiEPTGGISLDNFGIILQTCLEAGVPRVMPHVYSSIIDP 226 Salmonella enterica subsp. enter...
Q181P3       163 PMGGLKTKDEYIEVAKACAKHNFYL-EPTGGIDLDNFKEIVQIALDAGVEKVIPHVYTSIIDK 224 Clostridioides difficile 630
Q837J8       163 PMKGLAHKEEYQAVAAACAKYDFYL-EPTGGIDLENFEEIVQIAVDAGVKKIIPHVYSSIIDQ 224 Enterococcus faecalis
3MUX_A       165 PXKGLAHEEEYRAVAKACAEEGFAL-EPTGGIDKENFETILRIALEANVEQVIPHVYSSIIDK 226 Bacillus anthracis str. Sterne
Q8ELL9       159 PMGGTSRLEEYEAVAKACAKEDFYL-EPTGGIDVQNSPQIIEIALQAGVKKVIPHVYSSIIDG 220 Oceanobacillus iheyensis
Q8Y429       157 SIEGTKYLDELVYLTKIAADKGIYGiEPAGGIGADNILEITTAIKSTGIPFYMPHIFGKTIDK 219 Listeria monocytogenes
Q5WI55       157 PIDGEKRLDEVAAMVKAAVNAGLTIfEPTGGIDVDNVERIVQVCLDNGAETVIPHLYTSLIDQ 219 Bacillus clausii KSM-K16
WP_011707609 163 PMGGLTCRAEYQAVAEACARHSFWL-EPTGGIDLDNFEEIVRIALDAGVEKVIPHIYSSIIDS 224 Aeromonas hydrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap