Conserved Protein Domain Family
DUF1340

?
pfam07067: DUF1340 
Protein of unknown function (DUF1340)
This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 235 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 115703
View PSSM: pfam07067
Aligned: 3 rows
Threshold Bit Score: 463.702
Threshold Setting Gi: 75090014
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O34054   1 MSgKYNYAGLTKELHQRLVFEFNALKEKHPRTFTHHIMKTKQCNRQYARKYCQRFDKVIKERSKLSFSTLDDMSEYLTEG 80  Streptococcus virus O...
Q9XJD7   1 MK-RFEYAGLTKELHQRLVVEFSALKEQYSRAFTKHIMETKQCDRLQARKYFQRFDNVIKERSKLSPATLDDMREYITDG 79  Streptococcus virus DT1
Q9MCH7   1 MSgKYKYAGLTKELHQRLTLEFDALREEHRRTLTKYIMETKKCNRTEARKYFQRFDNVVKERSKLSPVTLEDMREYLTNC 80  Streptococcus phage S...
O34054  81 LVNDLQEYLSEHYSAPRWSCKTDSDKTNAGLTEELFLQYRNEIQELRAAHPNCFANYIMEVKGCSNQQAKTICTAINTIY 160 Streptococcus virus O...
Q9XJD7  80 LANDLENYLSKHCFSSSVKCRPDTYKRNAGLPEELFKQYCEEIKSLKAKYPNSFTAYIMDVKGCKYQKANSIRTAINTIY 159 Streptococcus virus DT1
Q9MCH7  81 LVNDLQEHLLENYSARSGSCKPDTNKTNAGLTKELFREFRKEIEVLRAAHPNRNAEYIMEVKGCSKHQAHTILTAINTVY 160 Streptococcus phage S...
O34054 161 TEIGILTPRKVVQLEGLLSRELFGKIAKHVFNKYEWPESLDSEVDRIYLEYRTKGDLGLEKESVKRALYKAIYMGL 236 Streptococcus virus O1205
Q9XJD7 160 TEIGIMTPRKVIQLEGLLSRELFGKIAKYVFNKYEWPESLDEEVNRIFLEYRTKGNLGSDKESVKRALYKAIYMGL 235 Streptococcus virus DT1
Q9MCH7 161 TEIGILTPRKVIQLEGLLSRELFGKIAKYVFNKYEWPESLDSEVDRIYLEYRTKGDLGLEKESVKRVLYKAISMGL 236 Streptococcus phage Sfi11
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap